ISPth1

  • Family IS5
  • Group IS903
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
GQ868752 Y Paracoccus thiocyanatus
Paracoccus thiocyanatus JCM 20756
DNA section
IS Length : 1054 bp

Ends


IR Length : 15/18

IRL : AGCGTTGTTGCAGAACTCATGAGCTTCCGGGATTCACGGCGTGAATCCGG
IRR : GGCATTGTTGCAGAAGTCGGCTTCAGGACATGATGGCCCTTTCCCCAGCT

Insertion site


Left flankDirect repeatRight flankDR Length
GTCATCCGCATTTTTAGGATCTCCGGCTA9

DNA sequence

AGCGTTGTTGCAGAACTCATGAGCTTCCGGGATTCACGGCGTGAATCCGGTGGGTTAAGAGCCTGCCATGAGCAAGCCCGAACCTGCCCGCTACCGTACG
ACCAACTGGAAATCCTATAACGACGCGCTGAAGCGGCGCGGATCTCTGCTCGTCTGGCTAGACCGGGACATGGACTGGCTTGCGCCGAAGGCAGGCAAGC
CCGGACGTCCGCCGGTCTTCTCCGACGCCGCCATCCAGTTCTGTCTGATGATCAAGGTGCTCTTCGGCCTGCCGCTTCGGCAAACGACCGGAATGGTCGC
CAGCATCCTCGAGATGGCTGGTCTGGACTGGCCGGTCCCGGACTTCTCCACGCTCAGCCGCCGCCAGAAGACAATCGTGGTCCAGCTTTCGTCGCGCCGG
GCTCCGGGCCCTCTGAACCTGCTGGTGGATAGCACCGGGATCAAGTTCCTGGGCGACGGAGAGTGGCTGGCGAGGAAGCATGGCACCCACCGCCGCCGCC
AGTACCGCAAGGTCCATCTGGCGATGGACACGGCGACCGGCGACATCCGGGCGGTGGAATTCACCTCTAGCCGCGAGGGCGACAGCCCCGTGCTCCCTGA
TCTTCTGGACCAGATCCCGGAAGACGAGGAAATCGGCACCGTTACCGGTGATGGCGCCTTCGACACCCGCCGTTGCCATTCGGCGATCCTTGCGCGAGGT
GGCACAGGGATCATTCCCATCCGCAGAAATGGCCGCCTCTGGAAAGAAGATTGCCCCGCCGCCTTGGCCCGCAACGACATCCTGAGGGCAACCCAGCGCC
TCGGCCGGACGATCTGGAAAAGGTGGTCCGGCTATCATGTCCGCAGCCGGGTCGAGGCCCGGATGAGGAATCTGAAATCCTTCGGCGAGCGGATCGCGTC
GAGGGACCCCGACCGCCAGACAGCCGAGATCCACATCCGCGTCGCCCTGATGAACCGCTTCAACGCCCTCGGCACCGCCGAGATCGAACGCGTGGCCTGA
CCTCAGCTGGGGAAAGGGCCATCATGTCCTGAAGCCGACTTCTGCAACAATGCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
933 bp310 aa681000+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSKPEPARYRTTNWKSYNDALKRRGSLLVWLDRDMDWLAPKAGKPGRPPVFSDAAIQFCLMIKVLFGLPLRQTTGMVASILEMAGLDWPVPDFSTLSRRQ
KTIVVQLSSRRAPGPLNLLVDSTGIKFLGDGEWLARKHGTHRRRQYRKVHLAMDTATGDIRAVEFTSSREGDSPVLPDLLDQIPEDEEIGTVTGDGAFDT
RRCHSAILARGGTGIIPIRRNGRLWKEDCPAALARNDILRATQRLGRTIWKRWSGYHVRSRVEARMRNLKSFGERIASRDPDRQTAEIHIRVALMNRFNA
LGTAEIERVA

 

Blast result :
Comments
ISPth1 is 94% aa similar to ISPpa3.
ISPth1 has been identified by its transposition into entrapment vector pMAT1 (sacB cassette). ISPth1 contains a sequence 5’-GCTGGTGG-3’ (position 421) identical to the Chi sites, which specify the place of action for RecBCD nuclease. ISPth1 is in 89% identical to ISPpa3 (aa level of the transposases).
References
1] Dziewit, L. and Bartosik, D. (2010) Direct submission
2] Dziewit, L., Baj, J., Szuplewska, M., Maj A., Tabin, M., Czyzkowska, A., Skrzypczyk, G., Adamczuk, M., Sitarek, T., Stawinski, P., Tudek, A., Wanasz, K., Wardal, E., Piechucka, E., Bartosik, D. (2012) PLoS ONE 7: e32277