ISH30

  • Family IS4
  • Group ISH8
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AM774418 ND Halobacterium salinarum
Halobacterium sp. NRC-1 pNRC200
Halobacterium salinarum R1 pHS3
DNA section
IS Length : 1654 bp

Ends


IR Length : 18/19

IRL : CATCCGTTGTAGTTTAACGCCTCACGCCAGCGCCGTCTGCTGATCTGAAT
IRR : CATCCGTTGTAGTTTAGCGGCGCGTTGAGGCGGTGTTTGTGCGGATAGTT

Insertion site


Left flankDirect repeatRight flankDR Length
GCAGACGATCTTGACGAACGTCACACAGCCAATT10

DNA sequence

CATCCGTTGTAGTTTAACGCCTCACGCCAGCGCCGTCTGCTGATCTGAATATCGTTGGGACTACCTGTCAGAGAAACCCGGTGGCTGCTGTGAGTTACGA
ACCACCGGATTCAGTGATTGTCGACCGGATCAAAAGAGCGTTTCCCTCTGATGAGTTGCGCGAGCGCGCTCGCGCAACGAATCTTGTCCAACGAGAGCGC
AAGTTCGACACTGTCGCGTTGTTCTACACCCTCTCACTGGGTTTCGCTGCTGGATCAGACCGCTCTATTCAGACATTTCTCGAACGGTTTGTCGAAATGG
CTGACTGTGACGAACTCGCTTATCCAACCTTCCACGGCTGGTTTTCGCCCGCGTTCGTTGCACTCCTGCGAGAGATTCTCGATGATGCCATCGAGAATCT
CGAACCGGGACAAACCGACCTTAGCGGACGTCTCGAACGCTTTCGAGACGTCCTCATTGTTGACGCCTCTATCGTCTCACTCTACCAAGACGCTACAGAT
GTCTACGCAGCGACTGGCGAAGATCAAGCTGGCGTAAAGCTCCACCTTACGGAATCACTCTCAACCGGACTTCCTACGCGGTTTCAAACGACTGACGCCA
AAACGCAGGAACGGAGCCAGCTACCCACCGGCGAGTGGGTAGCTGGCGCACTCGTCTTACTTGATCTCGGCTTCTACGACTTCTGGTTGTTCGACCGTAT
CGACCAAAACGACGGCTGGTTCGTCTCACGGGTCAAAGATGACGCAAACTTCGAGATCGTCGAAGAGCTTCGCACATGGCGGGGAAACAGTATTCCACTC
GAAGGCGAGTCGCTGCAGGACGTCCTCGACGACCTACAGCGACAGGAGATCGACGCTCGGATCACCCTCTCATTCGACCGCAAGCGAGGGTCGGGCGTCA
GCACGACCCGAACGTTCCGACTCGTCGGTGTGCTCAACGAGGACAGCGGTGAGTACCATCTCTACGTAACGAACCTTGCCAGAGACAACTACCACGCGCC
CGATATCGCACAGCTCTATCGGGCGCGCTGGGAGATTGAGCTGCTGTTCAAGGAACTCAAATCGCGCTTCGGTCTTGATGAGATCAATACGACAGATCCC
TACATCATCGAAGCGCTGATCATCGTAGCGGCGCTCTCGCTGCTGATGAGCCGCGTTATTGTGGATGAACTCCGCAAATTAGACGCAAAGCGGCAGGGAA
GCGACGACGACGCGGCCGCGTCGTCGACGCGTCTCCCACGCCGTCGGTGTTCTCACGCGCTCGAACGTCACGCACACTTGGTCCAACTGTACCTGATGGT
AGATCTGGGGTATGAACTGCCAGATCTCGACGAATTGCTGTTGTGGTCGTCACGAGATCCAAATCCACATCGACCAAGATTACGTGAGCAGGTTGAGTCA
GGCGAGTTCTGGTAGAAACTCGCCTGACAAGCCGGTCAGCTCAGACGTTGGTAGTAGTGACATCTCTGGATCGGCGACGCACTCACCGGAGTGAGTGCGC
CGCCTTCAGAGAGTGACGCAGATCTCATCATCCGAGACAGAAGAACATCCGTTCAGTTCTCCGATCACACTTCATCAGCGATTCGACTCAACACCGTCTT
GCTCAACTATCCGCACAAACACCGCCTCAACGCGCCGCTAAACTACAACGGATG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1335 bp444 aa811415+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MAAVSYEPPDSVIVDRIKRAFPSDELRERARATNLVQRERKFDTVALFYTLSLGFAAGSDRSIQTFLERFVEMADCDELAYPTFHGWFSPAFVALLREIL
DDAIENLEPGQTDLSGRLERFRDVLIVDASIVSLYQDATDVYAATGEDQAGVKLHLTESLSTGLPTRFQTTDAKTQERSQLPTGEWVAGALVLLDLGFYD
FWLFDRIDQNDGWFVSRVKDDANFEIVEELRTWRGNSIPLEGESLQDVLDDLQRQEIDARITLSFDRKRGSGVSTTRTFRLVGVLNEDSGEYHLYVTNLA
RDNYHAPDIAQLYRARWEIELLFKELKSRFGLDEINTTDPYIIEALIIVAALSLLMSRVIVDELRKLDAKRQGSDDDAAASSTRLPRRRCSHALERHAHL
VQLYLMVDLGYELPDLDELLLWSSRDPNPHRPRLREQVESGEFW

 

Blast result :
Comments
The transposase of ISH30 is 90% aa similar to ISH5 transposase from Halobacterium.
References
1] Pfeiffer F., Schuster S.C., Broicher A., Falb M., Palm P., Rodewald K., Ruepp.A., Soppa J., Tittor J., Oesterhelt D. (2008) Genomics 91: 335-346
2] Pfeiffer F. (2010) Direct submission