ISRel5

  • Family IS21
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_004041 ND Rhizobium etli
Rhizobium etli CFN 42 symbiotic plasmid p42d
DNA section
IS Length : 2587 bp

Ends


IR Length : 24/31

IRL : TGAGATTCAGCGTCAATCAGGATGAGACTCGCGCCGGGGTGTGACGGAGT
IRR : TGAGACGCTTGCGACAATCTGGATGAGATTCTTAGGTCGCGGTCGGGATC

Insertion site


Left flankDirect repeatRight flankDR Length
GCGATCTCGATCCTGATTGC0

DNA sequence

TGAGATTCAGCGTCAATCAGGATGAGACTCGCGCCGGGGTGTGACGGAGTGAGGGCGTAGCCCGATCGTAGTCATACCCCGGCGTGGCGCAGATTTTCGG
CGTCTCATGATCGCGGTCGGTCCGGTACATTTGCGGTTTTCTGGATTGGAGAACCAGTTTGTGCCGGGTCGCCATTTAACCGATCATCAGATGAGACTCT
TCATGAAGTACCGACAAACGCATTCCGTAGAGGTCGCCGCGTCAAAAGCGTCGATCAGCCGAGCCACGGCATACCGCCTCGCCAAGGAGGTACAACTGCC
TTCTCAGAGCAAAGCGCCGCGCGGACGCCGCCGCCCTGATCCCTTAGAGCTGATATTCGAGACCGAAGTCGTCCCGCTCCTGAAGGCCGCACCCGGTATC
CGTGCCGTCGCTGTCTACAACGAGATGCTGCGCCGACATCCAGAACTCTCTGAAGGTATCCGCCGCACGCTTGAACGACGCATTCGGTCGTGGCGTGCTG
TCCATGGCGAAGCGCAGGGGGTCATCTTCCGCCAAACGCACGAGCCAGGCCGGTTGGGCCTTTCGGATTTTACCGACGCCAGCGGTCTTGGTGTGACCAT
CGCCGGCCAGCCGCTTGATCACCTGTTCTATCACTTCCGGCTTGTCTGGTCGGGCTTCGAACATGCCCATGTCATTCTCGGCGGCGAAAGCTTTGTCGCG
CTGGCTGAAGGGCTTCAAAATGCCCTGTGGTCCGTGGGAGGTACGCCGCTTTATCATCGAAGCGACAGCCTGTCGGCGGCATTCCGCAACCTCGACGCCG
ATGCCAAGGTCGATCTCACCCACCGATACGATCAGCTTTGCTCCCATTATCGAATGACGCCGACGCGCAACAACAAAGGCGTCGCGCATGAGAACGGCTC
TATCGAAAGCTCCCATGGCCATCTCAAGAACTCTGTTCATGACGCCCTGCTGATGCGGGGGGCCAAGGAATTCGACGACCTCAGTTCTTACCGCGCCTTT
GTCGATGACATCGTCAGCCGTCGCAACGCTGCCCATGGCAAGCGCATTGATGCTGAGCGATCCCATCTGCAGGCGCTGCCCGAGCGCCGGACCACGGACT
TCGAAGAGATTGTCGTTACGGTGTCCCGGACGGGCGGCTTCACCTTGCGCAAGGTCTTCTACACCGTGCCATCCCGCCTGATCGGCCACAGGTTAAGAGT
TCGCCTGTTCGACGATCGGCTGGATGTCTTTGTCGGCGGTACGCATCTGATGACGTTGCGCCGAGGACGCGGCCATCCCGACGGCCGACACGACCAGGTC
GTCAACTACCACCACGTCATCCATTCCCTGCGCAAAAAGCCGATGGCGCTCCGCGGCCTCGTTTATCGCGACAAGCTCTTCCCGCGTCAGGAATATCGCA
AGGCCTTCGAAGCCCTCATCGAGCATCTTCCCGACAAGCAGGCTTGCAAGATCACCGTCGAACTCCTGGCGCTCGCGCATGACCGTGGTTGCGAACGCGA
ACTTGCCGAAGAATTGGCCAGGATACTCGATGCTGGTGACTTACCCAATCTGGCTACCATGCGAGCGCTCTTCGGTCCGGATCCAGCCAAGCTGCCGACC
GTTCATGTGCAACTCGCATCGCTCAACGGTTATGAGGCCCTGATCGGGACGGGAGAAGCGGCATGAAGAACGCCCACGTTATCGATGAAGCACGCCTCGG
CATCATGCTCAACGAGCTCCGGCTGCCGACGATCAAAATGCTGTGGCCACGATTTGCCGAAGAGGCGGACCGGGAAGGATGGCCGGCAGCTCGCTTCCTG
TCGGCTATTGCCGAGCACGAGCTGGCAGAGCGTGCCAATCGCAGGATTGAACGGCATCTCGCCGAAGCGCACCTGCCGCCCGGAAAGACCTTAGACAGCT
TCGCCTTTGACGCTGTACCCATGATCTCGAAGGCGCAGGTCATGGCAATCACCGCCGGCGACAGCTGGCTTGCCAAGGGAGCTAACATCCTCATGTTCGG
TCCGCCCGGCGGAGGAAAGAGCCATCTTGCTGCTGCCATCGGCCTTGCGCTGATCGAGAACGGATGGCGGGTCCTGTTCACCCGGACCACCGATCTTGTG
CAGAAGCTTCAGGTCGCCCGAAGGGAACTGCAGCTTGAGTCTGCCATCGACAAACTCAACAGGTACGACTTGCTCATCCTCGATGACCTCGCCTACGTCA
CCAAGGACCAGGCGGAAACAAGCGTGCTATTCGAGCTGATCTCGGCACGATACGAGCACCGGTCGATCCTGATCACCGCCAACCAGCCGTTCGGAGAGTG
GAACCGGGTCTTTCCCGACCCTGCCATGACACTCGCAGCAGTCGACCGGCTCGTGCACCATGCCACGATCTTCGAGATGAACGTCGAAAGCTATCGCCGC
AGAACTGCGCTTGAGGAAAAACGCCAGCGCGGCCGACCGGCCTCGTTTGCGACAATCAGGACATCAACGCTGTCTGTCGCGGAGCGGCAATCAGAAAACG
ACGAAGAACTTGTCAGCGGCAATCAGCATGATAATTTGATCCCGACCGCGACCTAAGAATCTCATCCAGATTGTCGCAAGCGTCTCA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
1476 bp491 aa1911666+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MRLFMKYRQTHSVEVAASKASISRATAYRLAKEVQLPSQSKAPRGRRRPDPLELIFETEVVPLLKAAPGIRAVAVYNEMLRRHPELSEGIRRTLERRIRS
WRAVHGEAQGVIFRQTHEPGRLGLSDFTDASGLGVTIAGQPLDHLFYHFRLVWSGFEHAHVILGGESFVALAEGLQNALWSVGGTPLYHRSDSLSAAFRN
LDADAKVDLTHRYDQLCSHYRMTPTRNNKGVAHENGSIESSHGHLKNSVHDALLMRGAKEFDDLSSYRAFVDDIVSRRNAAHGKRIDAERSHLQALPERR
TTDFEEIVVTVSRTGGFTLRKVFYTVPSRLIGHRLRVRLFDDRLDVFVGGTHLMTLRRGRGHPDGRHDQVVNYHHVIHSLRKKPMALRGLVYRDKLFPRQ
EYRKAFEALIEHLPDKQACKITVELLALAHDRGCERELAEELARILDAGDLPNLATMRALFGPDPAKLPTVHVQLASLNGYEALIGTGEAA

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
894 bp297 aa16632556+No
ORF function : Accessory Gene
AG : IS21 helper

ORF sequence :

MKNAHVIDEARLGIMLNELRLPTIKMLWPRFAEEADREGWPAARFLSAIAEHELAERANRRIERHLAEAHLPPGKTLDSFAFDAVPMISKAQVMAITAGD
SWLAKGANILMFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELQLESAIDKLNRYDLLILDDLAYVTKDQAETSVLFELISARYEHR
SILITANQPFGEWNRVFPDPAMTLAAVDRLVHHATIFEMNVESYRRRTALEEKRQRGRPASFATIRTSTLSVAERQSENDEELVSGNQHDNLIPTAT

 

Blast result :
Comments
ISRel5 ORFA (the transposase) is 72% aa similar to ISRm9 ORFA, and ISRel5 ORFB (helper of transposition) is 81% aa similar to ISAZo16 ORFB.
References
1] Lozano LF (2010) Direct submission.

2] González V, Santamaría RI, Bustos P, Hernández-González I, Medrano-Soto A, Moreno-Hagelsieb G, Janga SC, Ramírez MA, Jiménez-Jacinto V, Collado-Vides J, Dávila G. (2006) PNAS. 7;103(10):3834-9

3] Gonzalez V, Bustos P, Ramirez-Romero M.A, Medrano-Soto A, Salgado H, Hernandez-Gonzalez I, Hernandez-Celis JC, Quintero V, Moreno-Hagelsieb G, Girard L, Rodriguez O, Flores M, Cevallos MA, Collado-Vides J, Romero D, and Davila G. (2003) Genome Biol. 4 (6), R36

4] Quintero V, Cevallos MA, and Davila G. (2002) Mol. Microbiol. 46 (4), 1023-1032

5] Ramirez-Romero MA, Bustos P, Girard L, Rodriguez O, Cevallos MA, and Davila G. (1997) Microbiology (Reading, Engl.) 143 (PT 8), 2825-2831

6] Girard ML, Flores M, Brom S, Romero D, Palacios R, and Davila G. (1991) J. Bacteriol. 173 (8), 2411-2419