ISRel15

  • Family IS66
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_004041 ND Rhizobium etli
Rhizobium etli CFN 42 symbiotic plasmid p42d
Rhizobium etli CFN 42
DNA section
IS Length : 2497 bp

Ends


IR Length : 19/28

IRL : GTAAGCGACAAGCAGACCCCATCTGGCGAAGCAGCTTAGCGGTCGGCTAT
IRR : GTAAACGGCAAGCTGAGACCGTTCAGCGCGCGTAATTCCACGGCATGAGT

Insertion site


Left flankDirect repeatRight flankDR Length
TGGTCCGTCTCTGCAAGGAGCCTGTCAA8
AGGCAAGGCAGCATCAGGGAAATCTGCC8
GACTGAAAGTCGTCCCAGAGATCCGTCT8
AGCCCCAGGCGGTAAAGCCCGACAGGCC8
TCCAGCTCATGATACGACGGCC2
CGGATACGACGCTCATGATG0

DNA sequence

GTAAGCGACAAGCAGACCCCATCTGGCGAAGCAGCTTAGCGGTCGGCTATCGGTAGCGGACACGATGAACTGCTGTGAGCTTCTATGTCTGCGCCTAGCT
CTGGAACTAGAACTTTTCATATGATCGAGGCTGTTGCGGACCGATTTGAGGGCGCGCCTCGGCAGCTTCGGCGGCGCTGGTCGGACGATTTTAAAGCGCG
TGCAGTTGCAGAGGCACTCGAGCCTGGCTCGAGCGTGTCAGCGATCGCACGTCGGCTTGATATCCATCCGTCACAACTGTTTGGCTGGCGTCGCGCCGCC
CTGGGCTCTCACAAGGAGAACATAGCGCCGATCGGTCATAAGGCAGTCACGCCATCTGCCGACGGCGCGATAATCGAAGTTCTGATTGGCGATGTCGTCG
TGCGCGCTCCCGCCGATGTGGACGAAGCTCATCTGCAGCGTGTCATCCGGGCAGTTCGCTCAGCATGATCCCCGCAGGTGTAAAGGTCTTCCTCGCCAGT
CACCCCATCGACTTTCGTAAAGGGCCGGACAGTTTGCTGTCGCTGGTGCGCGACGCCGGCAGTGATCCGTTCAATGGCTCGCTTTATGTCTTCCGGGCGA
AGCGGGCGGACCGGGTCAAGATCGTCTGGTGGGATGGATCAGGGGTCTGCCTCTATTCCAAGCGGTTGGAGAAGGCGCAGTTCTGCTGGCCGCGGATCGG
CCACAACCGGGTGCAGCTCAATCACGCTCAGCTCATGGCGCTCGTTGACGGCATGGACTGGAAACGGGTGCGCTCAGTGGCGGTGAAGCCGCCGGAGATT
GTTGGGTAAAGGGCTGCGGCGAAGTGAATCAACCGCCTGAAAAGGCAGGAAAACCGGAGCAAATTGTGCTCTGGTAGGCCTCATGACGCCGCCCGATCTA
CAGCTCCCGGATGATGTAGAGACCCTGAAAGCCATGGTCCTTGCCATGGCCGAGAAGGCAGCGCGCACCGATGCTCTCGAGAGCGAGGTCGCAGACCTGA
AAGCCAGAAACGCCGATGCCGACGAACGCATCGAGCGACTGACCCAGATCCTGAAAGCCTTCGATCGCGCCCGCTTCGGCCGGCAATCGGAAAAGCTCGG
CTCTCCGGGCATCGATGATGAGCAGCAGGCTTTTGTCTTCGAGGAAATCGAGACCGGTATCTCGGCAATCCGAGCCAAGGTAAACAAGGGTGCCGCTGAT
CCCGATGCGAAACGTGCACCCCGGCCGCGCAAGGGCTTTGCACCTCATCTGGAACGAGTCGAAGTGGTGATCGAGCCGGATGAACTGCACGAACACATCG
GCAAACAGAAGGTGCTGATCGGAGAAGACGTCTCGGAGCGACTGGACGTCGTGCCGGCGAAGTTCCGCGTCATCGTCACCCGGCGGCCGAAGTATGCCTT
CAAGAACGAAGACGGCGTCATCCAGGCAGCCGCGCCCGCGCACATCATCGAGGGTGGCATTCCAACGGAAGCGCTTCTCGCCCAGATCGCTGTCTCGAAG
TATGCAGATGGCCTTCCGCTCTATCGACAGGAGGCAATCTATGCACGCGACAAGGTTGAGCTTGACCGGAAGCTGATGGCCCAATGGATGGGCAAGCTCG
GCTACGAGCTCGATATCCTGGCCGACTACATCCTCGCCGAGATCAAGAAGGCTGAGCGCATCTTTGCGGACGAGACGACATTGCCAACGCTCGCGCCCGG
ATCCGGATCGGCAAAGACAGCCTGGCTATGGGCTTATGCGAGGGATGATAGACCCTTTGGCGGTAGTGGCCCGCCGATGGTCGCCTATCGCTTCGAAGAT
AGCCGCGCTGGCGATCGCGTCGCCCGGCATCTGAATGGCTATCGCGGTATCCTTCAGGTGGACGGGCATGGTGCCTACAACAAGCTTGCCCGATCTGACG
GCGGCAATGACGGCGTGATGCTGGCCGGCTGCTGGTCCCATAGCAGGCGCAAGTTCTACGAACTCCACGCCTCGGACAGCTCCAAGATAGCCAGCGAGAC
GGTGGAATTGATGGCAAAGCTCTGGGAGGTGGAAGCGGCGGCCCGGGGGCAGAGCCCTGACGCGCGTGTCGCGGCACGTCAGGCGACATCTGCTGCAGTT
GTCACTGAGCTCTTCGCCCTGTGGCAAAAGACCCTGCCGCGGATCTCCGGCAAGTCGAAGCTCGCAGAAGCGATCCGCTATGCCACCTCGCGTCGCTCCA
TCTTCGAACGCTTCCTTACCGACGGCCGCATCGAGCTCGACAGCAACATCGTTGAGCGTGCCATCAGGCCCCAGACGATCACGAGAAAGAACAGTCTCTT
CGCCGGCAGCGATGGCGGTGGAAGGACCTGGGCGACTATCGCCACGCTCCTTCAGACGGCGAAGATGAACAACGTGGACCCGCAGGCTTGGCTCACCCAA
ACACTTGAGCGGATCGCCAACGGCTGGCCGAGCAGCGATCTCGATGCACTCATGCCGTGGAATTACGCGCGCTGAACGGTCTCAGCTTGCCGTTTAC
Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
384 bp127 aa85468+No
ORF function : Accessory Gene
AG : IS66 TnpA

ORF sequence :

MSAPSSGTRTFHMIEAVADRFEGAPRQLRRRWSDDFKARAVAEALEPGSSVSAIARRLDIHPSQLFGWRRAALGSHKENIAPIGHKAVTPSADGAIIEVL
IGDVVVRAPADVDEAHLQRVIRAVRSA

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
345 bp114 aa465809+No
ORF function : Accessory Gene
AG : IS66 TnpB

ORF sequence :

MIPAGVKVFLASHPIDFRKGPDSLLSLVRDAGSDPFNGSLYVFRAKRADRVKIVWWDGSGVCLYSKRLEKAQFCWPRIGHNRVQLNHAQLMALVDGMDWK
RVRSVAVKPPEIVG

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1593 bp530 aa8832475+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MTPPDLQLPDDVETLKAMVLAMAEKAARTDALESEVADLKARNADADERIERLTQILKAFDRARFGRQSEKLGSPGIDDEQQAFVFEEIETGISAIRAKV
NKGAADPDAKRAPRPRKGFAPHLERVEVVIEPDELHEHIGKQKVLIGEDVSERLDVVPAKFRVIVTRRPKYAFKNEDGVIQAAAPAHIIEGGIPTEALLA
QIAVSKYADGLPLYRQEAIYARDKVELDRKLMAQWMGKLGYELDILADYILAEIKKAERIFADETTLPTLAPGSGSAKTAWLWAYARDDRPFGGSGPPMV
AYRFEDSRAGDRVARHLNGYRGILQVDGHGAYNKLARSDGGNDGVMLAGCWSHSRRKFYELHASDSSKIASETVELMAKLWEVEAAARGQSPDARVAARQ
ATSAAVVTELFALWQKTLPRISGKSKLAEAIRYATSRRSIFERFLTDGRIELDSNIVERAIRPQTITRKNSLFAGSDGGGRTWATIATLLQTAKMNNVDP
QAWLTQTLERIANGWPSSDLDALMPWNYAR

 

Blast result :
Comments
ISRel15 is 76% (orfA), 98% (orfB) and 91% (orfC, the transposase) aa similar to IRle3.
References
1] Lozano LF (2010) Direct submission.

2] González V, Santamaría RI, Bustos P, Hernández-González I, Medrano-Soto A, Moreno-Hagelsieb G, Janga SC, Ramírez MA, Jiménez-Jacinto V, Collado-Vides J, Dávila G. (2006) PNAS. 7;103(10):3834-9

3] Gonzalez V, Bustos P, Ramirez-Romero M.A, Medrano-Soto A, Salgado H, Hernandez-Gonzalez I, Hernandez-Celis JC, Quintero V, Moreno-Hagelsieb G, Girard L, Rodriguez O, Flores M, Cevallos MA, Collado-Vides J, Romero D, and Davila G. (2003) Genome Biol. 4 (6), R36

4] Quintero V, Cevallos MA, and Davila G. (2002) Mol. Microbiol. 46 (4), 1023-1032

5] Ramirez-Romero MA, Bustos P, Girard L, Rodriguez O, Cevallos MA, and Davila G. (1997) Microbiology (Reading, Engl.) 143 (PT 8), 2825-2831

6] Girard ML, Flores M, Brom S, Romero D, Palacios R, and Davila G. (1991) J. Bacteriol. 173 (8), 2411-2419