ISRel16

  • Family IS21
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_007762 ND Rhizobium etli
Rhizobium etli CFN 42 plasmid p42a
Rhizobium etli Kim 5
DNA section
IS Length : 2597 bp

Ends


IR Length : 38/49

IRL : TGCAGATTCCGAGGCAATCCGCCCCCGCATTCCGAAATGATGCCGCCCCC
IRR : TGCCGATTCCGATGAAGCCGCCCCTTTGTTCCGAGATGATTGCGCCCCGG

Insertion site


Left flankDirect repeatRight flankDR Length
CATTCGTCGAATCATGTACGAGCTGGCA8
AAAAACCGCTCATAGTCCGCTCGCCGA7

DNA sequence

TGCAGATTCCGAGGCAATCCGCCCCCGCATTCCGAAATGATGCCGCCCCCCAATTCCGAGAATTAACCGCCCCCTTGTTCCGAGATGATGCCGCCCCCTC
ATTGGGGCTGTTTGTCGGGGTGTCCTGCTGGTGAGACGTTCTTCCTTTCAGTTGCTCGAGAGGAAGGAACGCGATGCCAGCGGAGAGACTAAAGATGCGG
CGTGTCCGCGAGATTCTGAGATACAGATTTGAGGAAGGCCTTGGCCACAAGTCGATTGCGGTGCGCGTTGGTACGGCGCCCTCGACGGTGCGCGAGACGT
TGCGCCGTTTGGAGCGTGCCGGACTTTCCAGGCCTTTGGGCGACGATGTCAGCGATGCGGTGTTGGAGGCGGCTCTCTATAAGGCTGCCGGCACGAAGAC
CGGTCACCGTCGCAGTGTCGAGCCGGATTGGGCGCATGTTCACCGGGAGCTGAAGCGCAAGCATGTGACGCTGCAGATCCTCTGGGACGAGTATATCGGC
CTTCATCCCGATGGATATCGCTACAGCCGCTACTGTGATTTGTATCGCGCTTGGGCGGTGAAGCTGCCGGTGACGATGCGCCAGGATCATGCGGCTGGCG
AAAAGCTGTTCGTCGATTATGCCGGCGACACAGTGACGGTGGTCGTCGACAGATTGTCGGGAAAGACGCGACAGGCGCATCTGTTCGTTGCGGTGTTGGG
GGCATCGAGCCTGTCATTTGCACACGCCCGCTGGAGCGAAACACTTCCCGACTGGATTGAGTGCCACCTGCTGGCGCTTGAGGCGTTTGGTGGCGCGCCG
GCATTGCTTGTCCCTGACAACGCCAAAGTGGCCGTGATCAAGGCCTGCCATTTTGATCCGCAGGTCAATCGCACCTATGCCGGGATGGCAGCTCACTACG
GAAGCTCTGTTCTTCCGACGCGACCACGCCGGCCGCGGGACAAGGCGAAAGTGGAGGCAGCGGTTCGCATTGTCGAGCGCTGGTTGCTTGGCCGAATGCG
CCACCGCGTCTTCTACAGCCTTGCCGACGTCAATGCGGCAATCATGGAATTGCTCGCCGATCTCAACGACACCCGTGTTCTGCGTCGTGTCGGGCGCACA
AGGCGACAGTTGTTTGAAGAGATCGACTATCCGGCCCTGCGGCCGCTTGCCGTCGAACGATACGTCTTTGCTGAATGGAAGATACGCCGGGCTGGGCTCG
ATTATCATGTCGATATCGACAAGCACTATTACTCCGTGCCCTATCGTTTTGCCCGTGAGCAAGTCGAGGCACGCATCACCGCCAATACCATCGAGATCTT
CTACAAGGGCGAGCGGATTGCCGCCCACCGGCGTTCGAGCGGCAATGGCAAGCACACGACAACTCCCGAGCACATGCCATCATCCCATCGCCGCTTTGCC
GACTGGACGATAGAGCGCATTAGCCGCGAGGCGTCGGCAATCGGATCGGACGTTGCATTGCTCTGCGAGCGTATTCTCGCTGATCGGCCGCATCCGGAAC
AGGGCTACAGAGCCTGCCTGGGCATTATCCGCCTCGTCAAAGCATTCGAACGCGAGAGGGTCAACGCGGCCTGCGGCCGAGCATTGGAAATCGGCGCTCG
AACCTATGGATCGGTGCGCTCCATTCTCGACAATCACCTCGACCGATCTTCGTCATCAAGCACAGCATCACCCGAGCCGATCAATCACTCCAACATCCGC
GGCCCCCGCTATTACCACTGAGGAGACGACATATGCTTGCACATCCCACCCTTGATAAATTGAATGCCATGGGCCTGACCGGCATGGCCAAGGCGTTCAA
CGAACTGATCAGCAACGGCGAGAGCGAACAACTCTCCCATGCCGAATGGCTCGGGCTGCTGCTCGAACGAGAATGGAGCTCGCGCCACGATCGCAAGCTT
GCCGCCCGTCTGCGGTTTGCCAAACTGCGCCACCATGCTGTGCCTGAGGATGTCGATTACCGCAGCGAGCGCGGTCTCGATCGGGCGCTGTTCATGAAGC
TGATCGGCGGCGACTGGATCGATGCCCACGACAACCTCGCGATCTGCGGGCCATCTGGCGTCGGAAAAAGCTGGTTGGCCTGTGCGCTCGGGCACAAGGC
TTGCCGCGATGATCGCTCGGTTCTCTATCAGCGCGTGCCGCGGCTGTTTGCCAATCTTGCTCTCGCTCACGGCGATGGCCGCTATGCAAGGCTGCAGCGA
ACCCTCGGGCACGTCCAGCTCTTGATCCTCGATGACTGGGGTCTGGAACCGCTCAACGAGCAGGCTCGCCACGACCTTCTGGAGATCCTCGAGGATCGCT
ACGGCCGCCGCTCGACAATCATTACCAGTCAGCTTCCGGTATCAGCCTGGCATGAGATCATCGGCAACCCAACCTACGCCGATGCCATCCTCGATCGCCT
CGTTCACAACGCCCATCGCATAGACCTATCCGGGGAAAGCTTGCGGCGAAATCAGCGCCGGAAATCTTGACTCGCTACACGAATGAACTGACAACAATCA
CTGCCAGCAGGACCCCAGCCTCAGGGGGGCGAGATCATCCCGGAATCCCGGGGCGCAATCATCTCGGAACAAAGGGGCGGCTTCATCGGAATCGGCA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
1527 bp508 aa1951721+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MRRVREILRYRFEEGLGHKSIAVRVGTAPSTVRETLRRLERAGLSRPLGDDVSDAVLEAALYKAAGTKTGHRRSVEPDWAHVHRELKRKHVTLQILWDEY
IGLHPDGYRYSRYCDLYRAWAVKLPVTMRQDHAAGEKLFVDYAGDTVTVVVDRLSGKTRQAHLFVAVLGASSLSFAHARWSETLPDWIECHLLALEAFGG
APALLVPDNAKVAVIKACHFDPQVNRTYAGMAAHYGSSVLPTRPRRPRDKAKVEAAVRIVERWLLGRMRHRVFYSLADVNAAIMELLADLNDTRVLRRVG
RTRRQLFEEIDYPALRPLAVERYVFAEWKIRRAGLDYHVDIDKHYYSVPYRFAREQVEARITANTIEIFYKGERIAAHRRSSGNGKHTTTPEHMPSSHRR
FADWTIERISREASAIGSDVALLCERILADRPHPEQGYRACLGIIRLVKAFERERVNAACGRALEIGARTYGSVRSILDNHLDRSSSSSTASPEPINHSN
IRGPRYYH

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
738 bp245 aa17332470+No
ORF function : Accessory Gene
AG : IS21 helper

ORF sequence :

MLAHPTLDKLNAMGLTGMAKAFNELISNGESEQLSHAEWLGLLLEREWSSRHDRKLAARLRFAKLRHHAVPEDVDYRSERGLDRALFMKLIGGDWIDAHD
NLAICGPSGVGKSWLACALGHKACRDDRSVLYQRVPRLFANLALAHGDGRYARLQRTLGHVQLLILDDWGLEPLNEQARHDLLEILEDRYGRRSTIITSQ
LPVSAWHEIIGNPTYADAILDRLVHNAHRIDLSGESLRRNQRRKS

 

Blast result :
Comments
ISRel16 orfA (the transposase) is 65% aa similar to ISSpu5, and orfB (helper of transposition) is 74% aa similar to ISPpu7.
References
1] Lozano LF (2010) Direct submission.
2] González V, Santamaría RI, Bustos P, Hernández-González I, Medrano-Soto A, Moreno-Hagelsieb G, Janga SC, Ramírez MA, Jiménez-Jacinto V, Collado-Vides J, Dávila G. (2006) PNAS. 7;103(10):3834-9

3] Gonzalez V., Santamaria R.I., Bustos P., Hernandez-Gonzalez I., Medrano-Soto A., Moreno-Hagelsieb G., Chandra-Janga S., Ramirez-Romero M.A., Collado-Vides J. and Davila G. (2005) Direct submission GenBank.