ISRel19

  • Family IS66
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_007762 ND Rhizobium etli
Rhizobium etli CFN 42 plasmid p42a
Rhizobium etli CFN 42
DNA section
IS Length : 2798 bp

Ends


IR Length : 17/24

IRL : GTGAGCGTACGGTGAGCTGTTTTTGCTGATCGGCCAAATCAGGCGATGTT
IRR : GTAAGCGTCCGGCGAACGCATTTTCGGGTGTCGAGAGATGGAATCTATAG

Insertion site


Left flankDirect repeatRight flankDR Length
TGAGCATTCTGATTGAAGCGATTTGCGC8
AGCAATTCCGACAACATCGACTACGGCG8
GGAGAAAGCGCATCCAAAGGCGTTTTTG8
GCGGCTCACGTAAGCATCACGGCGCTCA8

DNA sequence

GTGAGCGTACGGTGAGCTGTTTTTGCTGATCGGCCAAATCAGGCGATGTTCTGGCATTAGAACCAGCATTAGTGCTGACATTAATACCAGAACGAAGAGG
TTTCATGGCTCGCATAGAGATCATGTCCGGTACCGAGCGCAGACGGCGTTGGTCGGACGAGGCGAAGCTGAGGATACTTGCGGAAGCTGATGAGCCCGGT
GCTCGCATTGGCGATGTGGCGCGCCGGCACGACATTCATCCGGGCCAGATCCGCTTGTGGCGGCAATCATTCAACTATGCCGATCGGCCGACGGTGTTCC
TCCCGGTGGAAATCACGGAGGAGGTTGGCGTAAGCCAGCCGTCTACCGCATCAACAAGGCCGACGATCGTTGAGATCTTGCTTCGAAACGGTCGGAGCTT
GAAGGTTGCGGTTGACGTTGAGTTGAAGCTGCTTGGCCCGCTCGTCGCTTGCGTGGAGGCGGTATGATCGGCCCATCGGGGAATGTGAGGGTCTATCTGG
CCTGCGGAGTGACCGATATGCGGCGTGGCATTGATGGTCTGTCCGCGCTGGTCGAGACGGTCGTGAGGGAGGCACCGGGCTCGGGCGCAATCTTCGGCTT
TCGCGGAAAACGCGCGGACCGGATCAAGCTGCTTTGGTGGGATGGCCAGGGGTTCTGTCTGTTCTACAAGATTTTGGAGCGCGGATACTTTCCCTGGCCG
ACGGCGAAAGAGGGTGTAGCGCACCTGACGCAGGCGCAGCTTTCGATGCTCGTTGAGGGGATCGATTGGCGACGCCCGGCGTGGACTTCCGCTCCCGGCC
GAACGGGATAAAAGCTATATTTTGCAGGGGCATGGGAAGCTTAACGCTGGTGCGTCAGAGGCAAATCGGCTAGTTTCGCGGATATGGAAACAGCGCCGCT
GGACAGTCAGGACGAGCTCAATACTTTGCGCGCACTCGTCGCGGAACAGGCGGCAAAACTTGAGAGCCAGGAAGCCGAGGTCATCAAGCGAGACTCCATA
ATCGGGCTTCTTCGCGCGCAACTGGAGCTTCTCCGACATCGGCAACATGGCGCGTCTTCGGAAAAGATCGACAGGAAGATCGAGCAATTCGAGCTGATGT
TGGAGGAGATCGAGGCCTCCCGGGCCGAGGCTGAACAGCGCTCCGGGAAACCGCCTCTGCCGGAGTTGGACGACGCATCCGAGAAGCCGAAGCGCAAGCC
TCTACCCGATGATCTCACCACCGAAGAACTGGTCTATGCAGCTCCCTGCAATTGCCCGACCTGCGGTGGCACTTCGTTCCTGAAGGCGGCCGACAGAGTG
GTCCAGGTGCTGGAGCACGTGCCGGCGTCGGTCAAGATTGTCCGGCATGTCGAGAAGCGCATGATCTGCAGGGAATGCGATACGACAGTGGCTGGCGAGA
TGCCGACCTTGCCGATCGAGCGCGGCAAACCCGGGCCGGGGCTGCTCGCCCACATCATGATCGCCAAATTCGACGATCACATTCCCCTTTACCGCCTGTC
AGAGATGTACGACCGGTTGGGGATAGACATCTCCCGATCCGTAATGGCCGACTGGGTCGGCCGGGTATCTGCATTGCTGACACCACTTGTCCTGTTAATC
AGGGCCCATATCGCCGCACTCGACCGAATACATACGGACGATACCCCGGTCGATGTTCTCGACCCCGGGCGGGGCAAGACAAAAACCGGCAGGGTCTGGG
TCTACATCTTTGACGGCAGTGGCTATCAATCCGCCACTCCCGCAGCCATTGCCTATTACTACAGCCCCGACCGCAGGGGCGCACATCCGGCTGATCACCT
GGCAAGCTTCAGCGGCGTCATGCATGCCGACGGCTACGGGGGTTACAAGAAGCTCTATGGCAACCAGATCATTGAAGCCGCCTGCATGGCGCATGTGCGC
CGCAAGTTCCATGATGTGATAAAGCTCAAGCCGTCTCCGATCGCTGAGGAAGCGCTGTCACGCATCGGCGCTCTCTACGATATCGAGAACCGTATCCGAG
GCATGTCGGCTGACGAGCGGCGCACCCTGCGCCAACACCATGCCCGGCCTGTTCTGGACGAACTCAAGGCCTGGATCGAGGCGACACTCTCGACTTTGCC
TCAGAAGCAGAGGCTGGCCGAGGCGATGCGATATGCCCTGTCGCGATGGGCAGCCTTAAGCGTCTACATCGACGATGGCCGTGTCGAAATCGACAACAAC
ATCGCTGAACGAGCCATGCGTCCGCTTGGAATTGGAAGGAAGAACTGGCTGTTTGCCGGCTCGGACAAGGGCGGCGAGCGCATCGCCAACATCCTCACCA
TCATCGAGACGGTCAAACTGCAAGGCCATAATCCAGAGGTCTATCTGACGGATGTCCTGACCCGGATCCAGGATCACCCCGAAGACCGAATTGAAGACCT
CCTGCCTTGGAACTGGACGCCGGCAAAAGCTCGATGCGAGGCCGCCTGATGGCGCGCTCGAGGTTCATCTACACACTCAGCCAAGTCGCCGGCATGATCG
GCGAAAACCTCGAACTGATCGAAGAAGTGACCGCAAACTCGGACAACATCTCCGAAGGCGAACTGGTTTACGTCGGCGATGGCAGTGAAGACGGCACGAA
GGGTCTGACCGAGAATGGCATCGAAGAACTTCAAAGCCTACTCGCCGACATCAGGACGTGGGACGGCGGTATCCGCGAGTTCCTCATCGACACACAGTGC
GATCCCGAAATAATCGACCGCATCATGGCCGATGAGATGAAACGCGGCCTATAGATTCCATCTCTCGACACCCGAAAATGCGTTCGCCGGACGCTTAC
Protein section
ORF number : 4

 

ORF 1
LengthBeginEndStrandFusion ORF
363 bp120 aa105467+No
ORF function : Accessory Gene
AG : IS66 TnpA

ORF sequence :

MARIEIMSGTERRRRWSDEAKLRILAEADEPGARIGDVARRHDIHPGQIRLWRQSFNYADRPTVFLPVEITEEVGVSQPSTASTRPTIVEILLRNGRSLK
VAVDVELKLLGPLVACVEAV

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
348 bp115 aa464811+No
ORF function : Accessory Gene
AG : IS66 TnpB

ORF sequence :

MIGPSGNVRVYLACGVTDMRRGIDGLSALVETVVREAPGSGAIFGFRGKRADRIKLLWWDGQGFCLFYKILERGYFPWPTAKEGVAHLTQAQLSMLVEGI
DWRRPAWTSAPGRTG

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1566 bp521 aa8842449+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

METAPLDSQDELNTLRALVAEQAAKLESQEAEVIKRDSIIGLLRAQLELLRHRQHGASSEKIDRKIEQFELMLEEIEASRAEAEQRSGKPPLPELDDASE
KPKRKPLPDDLTTEELVYAAPCNCPTCGGTSFLKAADRVVQVLEHVPASVKIVRHVEKRMICRECDTTVAGEMPTLPIERGKPGPGLLAHIMIAKFDDHI
PLYRLSEMYDRLGIDISRSVMADWVGRVSALLTPLVLLIRAHIAALDRIHTDDTPVDVLDPGRGKTKTGRVWVYIFDGSGYQSATPAAIAYYYSPDRRGA
HPADHLASFSGVMHADGYGGYKKLYGNQIIEAACMAHVRRKFHDVIKLKPSPIAEEALSRIGALYDIENRIRGMSADERRTLRQHHARPVLDELKAWIEA
TLSTLPQKQRLAEAMRYALSRWAALSVYIDDGRVEIDNNIAERAMRPLGIGRKNWLFAGSDKGGERIANILTIIETVKLQGHNPEVYLTDVLTRIQDHPE
DRIEDLLPWNWTPAKARCEAA

 

Blast result :
ORF 4
LengthBeginEndStrandFusion ORF
306 bp101 aa24492754+No
ORF function : Passenger Gene
Annotation : Description :

ORF sequence :

MARSRFIYTLSQVAGMIGENLELIEEVTANSDNISEGELVYVGDGSEDGTKGLTENGIEELQSLLADIRTWDGGIREFLIDTQCDPEIIDRIMADEMKRG
L

 

Blast result :
Comments
ISRel19 is 91%(orfA), 100%(orfB), 97%(orfC) and 97%(orfD) aa similar to ISAtu6.
References
1] Lozano LF (2010) Direct submission.

2] González V, Santamaría RI, Bustos P, Hernández-González I, Medrano-Soto A, Moreno-Hagelsieb G, Janga SC, Ramírez MA, Jiménez-Jacinto V, Collado-Vides J, Dávila G. (2006) PNAS. 7;103(10):3834-9

3] Gonzalez V., Santamaria R.I., Bustos P., Hernandez-Gonzalez I., Medrano-Soto A., Moreno-Hagelsieb G., Chandra-Janga S., Ramirez-Romero M.A., Collado-Vides J. and Davila G. (2005) Direct submission GenBank.