ISRel20

  • Family IS5
  • Group IS1031
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_007762 ND Rhizobium etli
Rhizobium etli CFN 42 plasmid p42a
DNA section
IS Length : 930 bp

Ends


IR Length : 15/16

IRL : GAGCCCGATTTAAAAGAAGTTGAGCGATAACAGTCAGTTGTGATTCCCTA
IRR : GAGCCCGATTCAAAAGTTCATTCGTATATCCAATACCTTGCGATGCGCCT

Insertion site


Left flankDirect repeatRight flankDR Length
CAATGCCTGATTAGGTGAAA0
ATCCCTAGGATTAGATATCTGGA3

DNA sequence

GAGCCCGATTTAAAAGAAGTTGAGCGATAACAGTCAGTTGTGATTCCCTATTGGTGCTAAATCAAATGGGGTTTCGATGAGCTGGACTGCTATCGCTCGC
CGTGAGCATAACCGAGACGTGCTTCGTTTTCCAAGTGATTTGAAGGACCGGGAATGGGCGTTGATCAAACCGCTGATCCCGCCAGCGCGTCGTGGCGGGC
GGCGTCGGACGACGAATATGCGCTCGGTCGCGGAGGCGATCCTCTATATCGCCTCGAGCGGCTGCCAATGGCGCATACTGCCGGGCGATTTTCCGCCGGT
TTCGACAGTGCGCGGTTATTTTTATGCTTGGCGCGCGATCGGACTGTGGCAGAGCATCAACCAGCTTCTGGTGATGGCGGCGCGGGAAATCGAGGGACGG
GAGGCGCAACCGACGGCAGGGATTATCGACAGCCAAAGCGTCAAGGCCACGCAAAGCGGCGGAATATCCGGCTATGATGCAGGCAAGAAGATTAAGGGCC
GCAAGCGTCAGATTGTCACCGATACGCTTGGATTTCTGATCTTCGTGTTCATCCATGCTGCCGACATACAGGATCGCGACGGCGCACCCCATGTCCTCAA
GGCGATCCGCCGCCGTTTTCCGTGGCTGCGCCACATCTTCGCCGATGGTGGCTACGCCGGAGCCAAGTTGAGGCGAGCAATGAGCGGCCATGGTGACTGG
ACGATCGAAATCGTCAAGCGTTCGGATCACGCCAAGGGCTTCGTCGTCCTGCCCAAGAGATGGGTGGTGGAAAGGACTTTCGCCTGGCTTGGACGCTGCC
GCCGTCTCGCCAAGGATTGGGAGAAATCGATCGAAAGCGCAACCGCATGGGCGCAAATCGCTTCAATCAGAATGCTCATAAGGCGCATCGCAAGGTATTG
GATATACGAATGAACTTTTGAATCGGGCTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
837 bp278 aa77913+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSWTAIARREHNRDVLRFPSDLKDREWALIKPLIPPARRGGRRRTTNMRSVAEAILYIASSGCQWRILPGDFPPVSTVRGYFYAWRAIGLWQSINQLLVM
AAREIEGREAQPTAGIIDSQSVKATQSGGISGYDAGKKIKGRKRQIVTDTLGFLIFVFIHAADIQDRDGAPHVLKAIRRRFPWLRHIFADGGYAGAKLRR
AMSGHGDWTIEIVKRSDHAKGFVVLPKRWVVERTFAWLGRCRRLAKDWEKSIESATAWAQIASIRMLIRRIARYWIYE

 

Blast result :
Comments
ISRel20 is 85% aa similar to ISGdi1.
References
1] Lozano LF (2010) Direct submission.

2] González V, Santamaría RI, Bustos P, Hernández-González I, Medrano-Soto A, Moreno-Hagelsieb G, Janga SC, Ramírez MA, Jiménez-Jacinto V, Collado-Vides J, Dávila G. (2006) PNAS. 7;103(10):3834-9

3] Gonzalez V., Santamaria R.I., Bustos P., Hernandez-Gonzalez I., Medrano-Soto A., Moreno-Hagelsieb G., Chandra-Janga S., Ramirez-Romero M.A., Collado-Vides J. and Davila G. (2005) Direct submission GenBank.