ISRel21

  • Family IS3
  • Group IS407
MGE type ISRelated element(s) :
Isoform Synonym(s) ISRel14
Accession numberTranspositionOriginHost
NC_007762 ND Rhizobium etli
Rhizobium etli CFN 42 plasmid p42a
DNA section
IS Length : 1200 bp

Ends


IR Length : 21/28

IRL : TGGACCAGTTTTGGTTAGAGTTTTCCGGTGCATTTTCCTGGCTGGGAAAG
IRR : TGGACCACCGGATGCTAGAGTTTTCCGGCTTTATTCAGGGAGGCGGGCTG

Insertion site


Left flankDirect repeatRight flankDR Length
AACCCTTCAAACACGTTTGGGA2

DNA sequence

TGGACCAGTTTTGGTTAGAGTTTTCCGGTGCATTTTCCTGGCTGGGAAAGGGACCAGAAGACGATGAAAGCGTCGCAGTTTTCGGACGCTCAGAAGGCGT
TCATTCTGAAGCAAGGTGATGAAGGCGTGTCGGTTGCTGAAATCTGCAGGAAGGCGGGGATCAGCCAGGCGACTTATTTCAACTGGAAGAAAAAATACGC
GGGCATGCTGCCACCGGAGATGAAGAGGCTGAAACAGCTCGAGGACGAGAATTCGCGCCTGAAGAAGATCGTCGCGGATCTGACGCTGGACCGCGAGATG
TTGCAGGATGTCATCCGCCGAAAGCTCTAAGGCCTGCTCGGAAGCGGGAGATGGTGAAAGGCATGTGCTGCGATTGGGCGATCTCGATCCGACGTGCTTG
TGGAGCGTTGAACTTCGATCGATCAACTCACCACTATACCTCTCGCCGTGCTGATCAGGCCGGTCTGGAACGTCGTATTCGCGAGATCTGCGAGATCCGT
GTGCGGTACGGCTATCGCCGCGTGCATGTGCTGTTGGAACGCGAGGGTTGGGGCACCAACATCAAGCGAACCTACCGCATTTACAGGGACTTGGGGCTAC
AGTTGCGGAACAAGACACCGAAGCGGAGGGTAAAGGCCAAGCTTCGCGAGGATCGGCACATGGCCGTCGGACCCAACGACGTCTGGGCGATGGACTTCGT
CCATGACCAACTCGCAATCGGTAAGAAACTGCGCGTGCTGACGGTGGTCGACACCTTCTCGCGCTACGTGCCGGTGCTTGATCCACGTCATAGCTATAGA
GGCGAAGACGTTGTGCAAACCCTTGAACGGGTGTGCCAAAAAGCCGGCTATCCGAAAACGATCCGTGTCGACCAAGGGACGGAATTCGTGTCGCGCGACT
TGGACCTGTGGGCCTATTCCAAGGGCGTGACGTTGGACTTCTCACGCCCCGGCAAGCCAACTGATAATGCCTTCATCGAAGCGTTCAATGGCCGCTTCCG
TGCAGAATGCCTGAACCAGCATTGGTTCCTGACCCTTGCGGATGCCCGCGAAAAGATGGAGGATTGGCGTAGATACTACAATGAGGAAAGACCTCATGGT
GCGATCGGCAACAAGGTGCCGATCTCGTTGGTGAATTCAGGGTGCGCAACCAGCCCGCCTCCCTGAATAAAGCCGGAAAACTCTAGCATCCGGTGGTCCA
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
267 bp88 aa64330+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MKASQFSDAQKAFILKQGDEGVSVAEICRKAGISQATYFNWKKKYAGMLPPEMKRLKQLEDENSRLKKIVADLTLDREMLQDVIRRKL

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1026 bp341 aa1411166+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

NLQEGGDQPGDLFQLEEKIRGHAATGDEEAETARGREFAPEEDRRGSDAGPRDVAGCHPPKALRPARKREMVKGMCCDWAISIRRACGALNFDRSTHHYT
SRRADQAGLERRIREICEIRVRYGYRRVHVLLEREGWGTNIKRTYRIYRDLGLQLRNKTPKRRVKAKLREDRHMAVGPNDVWAMDFVHDQLAIGKKLRVL
TVVDTFSRYVPVLDPRHSYRGEDVVQTLERVCQKAGYPKTIRVDQGTEFVSRDLDLWAYSKGVTLDFSRPGKPTDNAFIEAFNGRFRAECLNQHWFLTLA
DAREKMEDWRRYYNEERPHGAIGNKVPISLVNSGCATSPPP

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1103 bp367 aa641166+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKASQFSDAQKAFILKQGDEGVSVAEICRKAGISQATYFNWKKKYAGMLPPEMKRLKQLEDENSRLKKIVADLTLDREMLQDVIRRKALRPARKREMVKG
MCCDWAISIRRACGALNFDRSTHHYTSRRADQAGLERRIREICEIRVRYGYRRVHVLLEREGWGTNIKRTYRIYRDLGLQLRNKTPKRRVKAKLREDRHM
AVGPNDVWAMDFVHDQLAIGKKLRVLTVVDTFSRYVPVLDPRHSYRGEDVVQTLERVCQKAGYPKTIRVDQGTEFVSRDLDLWAYSKGVTLDFSRPGKPT
DNAFIEAFNGRFRAECLNQHWFLTLADAREKMEDWRRYYNEERPHGAIGNKVPISLVNSGCATSPPP

 

Blast result :
Comments
ISRel21 is 96% aa similar to ISRle5.
The third ORF is a putative ORFAB transposase reconstructed in silico by a possible +1 frameshift.
References
1] Lozano LF (2010) Direct submission.
2] González V, Santamaría RI, Bustos P, Hernández-González I, Medrano-Soto A, Moreno-Hagelsieb G, Janga SC, Ramírez MA, Jiménez-Jacinto V, Collado-Vides J, Dávila G. (2006) PNAS. 7;103(10):3834-9
3] Gonzalez V., Santamaria R.I., Bustos P., Hernandez-Gonzalez I., Medrano-Soto A., Moreno-Hagelsieb G., Chandra-Janga S., Ramirez-Romero M.A., Collado-Vides J. and Davila G. (2005) Direct submission GenBank.