ISRel25

  • Family IS110
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_004041 ND Rhizobium etli
Rhizobium etli CFN 42 plasmid p42a
Rhizobium etli CFN 42 symbiotic plasmid p42d
DNA section
IS Length : 1638 bp

Ends


Left end : AACACCTTCGGAAGTCTGCGTTGAATGAGGCTTTGACCAGCTGCGTAGCCCCCATCAGGCGAAGCAGGTGGTCATAGCCAGGCCTCAGGTCTCACAGTGG
Right end : TGACGATTGGCCGGGCCTACATCATAATTCAAACGCATCGGGAGACCGACGCGATAACGACCTGCTGCCAAAACGGCGTTTCATTCCGATTATAGGACGT

Insertion site


Left flankDirect repeatRight flankDR Length
TCAGTGCCGTTGTCGGAGAC0
TCGGTGCCGTTGTCGGAGAC0

DNA sequence

AACACCTTCGGAAGTCTGCGTTGAATGAGGCTTTGACCAGCTGCGTAGCCCCCATCAGGCGAAGCAGGTGGTCATAGCCAGGCCTCAGGTCTCACAGTGG
TTTTGCGAAGCCACACTGTAAAGGAGACAGGCTATGACCGATTGTGACATTACCGCATTTACCCCCGTTCTGGCAGCTATCGATGTTTCCAAAGAACGCC
ACGAGGTGCTGATCGAAGCACCGGACAAAAAGCGTCGACGTCGAGTGATCGTGCTCAACAATCTCGATGAGTTCGATCGCCTCATCGGCCTGCTGCGTAG
CTATCAGCGTCCTGTCCGTGTCGCCTTTGAGGCAACGGGAAACTATCATCGCGCATTGGCATATCGGCTCGGCTTAGCGGGCTTCGAGATCAAATTGATC
TCGTCCATCGCACTGGCTCGGACCAGGGAGGCACTGCATAATTCCTGGGATAAAAATGATCCAAAGGATGCCCAGGTTATCCTCCATATGATGACCATTG
GTGCCGAGCAGTTCTACCATGACCCGTTGATGCGCGGCACCAACGACATTCAGGAGTTGTCGAAGACCCACGATATGATCTCAAGGTCGAAGACCGAACT
GTGGCATCGGATTCTGACGCATTACCTGCCGTTGTATTTCCCTGAAGCGGATCGCTTCCACCGCAGTTCGCGCAGCGACTGGTTCTTTGCTTTCCTTGAA
CTGTTTCCGTCTCCGCACTTCATCGCAGCCATGAACAAGGACGCTTTCATCAAAGCTGCCTGGGAGGTGGTTGGTCGCAAAGTTGGCAAAGAGCGTTTGT
TGGCAGATATTTACGCAACGTCCGCCCGTTCGATAGGCCTTCCAGTTGCACCGGACTCTGACGCTATCTGCATGTTTCGTATGATCCTGGCCGAGGGCAG
AAGCCTAATCGCCCAACGTAATGAGATCGAGGCGCGTGCGGTTGCGATGCTGAAGGACAACGCAGATTACCAGCTCTTATGCACAATCCCCGGCATTGGC
CCAATCAATGCTCTGACAATCATGGCAGAAGCTGGGGACCTGCGCCGGTTTCAACACCATCGCCAGTTCCTGAAGTTCTGCGGCATGGATCTTGCGACAA
TCCAGTCAGGAATGTTTCGAGGCCAGACCAAACTCTCCAAATATGGAAATGCACGGCTGAGGCGGACCTTATGGATGGCAGCTCAAGTCGCGATATTGCA
GCGCGCCAACAGCTTCCGCGACAAGTTCGAGCGATACATCACCAAGGACCGTCACAACACCCATTTACGTCGCAAGGCGTCAACAGCAATCGCCGCCAAG
ATGGCCCGCACCGTACATGCGGTTATCAAAAGCGGTGAACCTTATCGCCCCTTCTTTGAAGGGACGATCCACAGCGGAAGGACCCTTCTCTGACAGTGCC
GTGGAGGCGTTGAGCTGCTCAGCGACCTCGTAGATAATGTTCAGGCCTTCCGCTCGACGGCAAAAAGGATCTCGTCTTAAGGACGGTGAGAGCCGCGATC
ATGCGTACTCTGTGTTTGTTATGGGAGAGACCGTTCGTTGACGATTGGCCGGGCCTACATCATAATTCAAACGCATCGGGAGACCGACGCGATAACGACC
TGCTGCCAAAACGGCGTTTCATTCCGATTATAGGACGT
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1260 bp419 aa1341393+No
ORF function : Transposase
Chemistry : DEDD

ORF sequence :

MTDCDITAFTPVLAAIDVSKERHEVLIEAPDKKRRRRVIVLNNLDEFDRLIGLLRSYQRPVRVAFEATGNYHRALAYRLGLAGFEIKLISSIALARTREA
LHNSWDKNDPKDAQVILHMMTIGAEQFYHDPLMRGTNDIQELSKTHDMISRSKTELWHRILTHYLPLYFPEADRFHRSSRSDWFFAFLELFPSPHFIAAM
NKDAFIKAAWEVVGRKVGKERLLADIYATSARSIGLPVAPDSDAICMFRMILAEGRSLIAQRNEIEARAVAMLKDNADYQLLCTIPGIGPINALTIMAEA
GDLRRFQHHRQFLKFCGMDLATIQSGMFRGQTKLSKYGNARLRRTLWMAAQVAILQRANSFRDKFERYITKDRHNTHLRRKASTAIAAKMARTVHAVIKS
GEPYRPFFEGTIHSGRTLL

 

Blast result :
Comments
ISRel25 is 80% aa similar to IMex12.
References
1] Lozano LF (2010) Direct submission.
2] González V, Santamaría RI, Bustos P, Hernández-González I, Medrano-Soto A, Moreno-Hagelsieb G, Janga SC, Ramírez MA, Jiménez-Jacinto V, Collado-Vides J, Dávila G. (2006) PNAS. 7;103(10):3834-9
3] Gonzalez V, Bustos P, Ramirez-Romero M.A, Medrano-Soto A, Salgado H, Hernandez-Gonzalez I, Hernandez-Celis JC, Quintero V, Moreno-Hagelsieb G, Girard L, Rodriguez O, Flores M, Cevallos MA, Collado-Vides J, Romero D, and Davila G. (2003) Genome Biol. 4 (6), R36
4] Quintero V, Cevallos MA, and Davila G. (2002) Mol. Microbiol. 46 (4), 1023-1032
5] Ramirez-Romero MA, Bustos P, Girard L, Rodriguez O, Cevallos MA, and Davila G. (1997) Microbiology (Reading, Engl.) 143 (PT 8), 2825-2831
6] Girard ML, Flores M, Brom S, Romero D, Palacios R, and Davila G. (1991) J. Bacteriol. 173 (8), 2411-2419