ISRel8

  • Family IS66
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_004041 ND Rhizobium etli
Rhizobium etli CFN 42 symbiotic plasmid p42d
DNA section
IS Length : 3226 bp

Ends


IR Length : 17/22

IRL : GTAACCGGTGCTCCGCTCCCACGTTGTCTTTCCTGCCATGATCTGTGATC
IRR : GTAAGCGATGTGCCGCTCACACCTCGACAAAGAAGCAGTTTTTTGATGGC

Insertion site


Left flankDirect repeatRight flankDR Length
GCTGTTCCGACGGATCGCATTTAATCGCG8

DNA sequence

GTAACCGGTGCTCCGCTCCCACGTTGTCTTTCCTGCCATGATCTGTGATCGCCTTTCCATGGACGAGCAACGGGAGTTTCTCCATGGAGACTACATTGGA
GGTTCTCACAACCAGGAAGTCTGGACGTGAGGTTCACCGGCATTGGCCGGATGACGTGAAGGCGCAGATCGTTTCGGAGAGCCTTCGGCCCGGCGCGATG
GTAAGTGAGGTCGCAGAGCGGCATGGGTTGAAGCCGAACCACCTCTCCACTTGGAGAACGATGGCGCGGCAGGGTAAGTTGCTTCTGCCCGCACCCGAAG
ACCCGATGGAGTTTGCAGCGGTAATCGTTGATCCGCCCGTTTCGGAGCCGCCGATCAAGAAAGCCAGTCGCGCCGAGATCATCGTCGGTTCCGTCACCAT
TCGTCTGGAAGAAGGTGCGTCTGCCGCTCGGATCGCCGCTGTCGCGCGTGCCTGTGCGGCTCCCGCATGATCTTTCCATCCAACCGCGTGCGGATCATGG
TGGCGACCAAGCCAGTCGACTTTCGCAAAGGCCATGATGGCTTGGCGGCACTGGTCAAGAACGAGCTACACAAAGACCCATTCACTGGAACTGTCTTCGT
ATTCCGGTCGCGCAAAGCAGATCGGTTAAAGCTGATCTACTGGGACGGCAGCGGTCTGGTGATGGCATACAAGCGGCTGGAGGAACACACGTTCACTTGG
CCGGGCATCAAGGATGGCCTGATGACACTGGGCCATGCTCAGTTCGAGGCGCTGTTTGCAGGGCTCGACTGGCGTCGGGTCCGTGCGGTAGAAGCGAGAG
CACCGGACGCCATCGAATAGATGCGGCACGATGACTCGGTCGGCAAATTCCGACGGCGAAGCGCCGCTGGTTTTGATAGGCTTCCACCATGTTGGACACC
GCCGATTTCCCTGACGATATCGATGCCCTGAAGACGATGCTGATCGCGGCGCAAGCGCGTGAAGTTCGTAAGGATGAGCGGATCGAGCGACTGGAGAAGC
TTGTCGCCGCATTCAAGCAGGCTGCCTTCGGTCGCAAATCCGAGAAGGCTGATCCTGAGCAGTTCGATCTCGCGCTGGAAGACCTGGAAACGACCATCGC
TGCCATCCATGCCGAAGACGAGGCCGATACATCCTCGGGCAAGCAGCGATCCAAATCCCGCGCCGTCAATCGCGGCTCTCTTCTCGCCCATCTTCCTCGT
ATCGAAGAGATAATTGAACCGGAAAGCCTGATCTGCGCTTGCGGCGGTTGCCTGCATCGCATCGGAGAGGACGTGTCTGAGCGGCTGGATGTTATCCCGG
CGCAGTTCCGCGTCATCGTCACTCGCCGACCCAAATATGCCTGCCGTGCCTGTACTGATGGCGTTGCCCAGGCTCCAGCGCCCGCACGACTGATCCAAGC
CGGATTGCCGACAGAGGCAACCATCGCGCATGTGCTGGTGTCCAAATACGCCGACCATCTGCCGCTTTATCGACAGGCCCAGATTATGAGCCGCCAAGGC
ATCGATCTCGACCGTTCCACTCTGGCCGATTGGGTTGGTCGGGCGGCATTCGAGTTGCGCCCGGTCTTCGACGCTTTGATCGCCGATCTAAAGCGCTCGA
CAAAACTGTTCATGGACGAAACCCGTGCGCCGGTCCTCGATCCAGGCTCTCGCAAAACCAAGACCGGATACTTCTGGGCGCTGGCCCGCGACGACCGACC
ATGGAGCGGCGGGGCTCCACCCGGAGTGGCTTTCACCTACGCTCCCGGTCGTGGCGGCCAACATGCCGAACGGATATTGCGGGGGTTCACGGGCGTTCTC
CAAGTGGACGGCTACGCCGGATATAATCGGCTGATCGCACCGGACCGTGTCGGCCCGGACATCCGGCTTGCCTATTGTTGGGCACATGCACGGCGCAAGC
TGGTCGAGATCACTCGTACCGGCACAGCGCCGATTGCCGAGGAAGGCGTGGAGCGGATTGGTGAACTCTATCGGGTCGAGTCCGAGCTACGCGGGCTTCC
CGCAGAAGCTCGCCTCGCCGGGCGACAGGAACGATCAGCGCCATTGATTGCGGACATGCGAACTTGGCTCACGCAGCATCGTGCCCGCGTCGCTGGCAAG
TCGTCGCTTGGCGAGGCGCTCGCCTACATCGCCAAATATTGGGATGGCCTCTGCGTCTTCTTGACCGACGGTCGGATCGAGATCGACAACAATAGTATCG
AGAGAACTATCCGGCCGATAGCGCTCAATCGGAAGAACGCTCTCTTCGCCGGGCACGACATGGGAGCACGGAATTGGGCAACCATCGCCTCGCTCATCGA
GACGTGCAAGCTCAATGCCGTTGATCCACAAGCCTACCTCACCAGCACGCTCACCGCTATCGTAAACGGCCATAAGCAAAACCGGATCGATGAACTCCTG
CCGTGGAATCATCCGGTTTAGTATGGTCAATCGCAAAATGACTGCAGCAATCAGACGCGAAGAGACATAGGAACCTTATCGTTCCGTCGGCTACGATTAA
CGCTATCTACGGGTTGATCTGATGTAAGCGGGAAGCCTAAATGCAAGTACGAATGCGGCTAGGTAAAATCCAAAGATGTGGATCATACTCTTCCAGATGT
TCACCTCTATCGGCGACTCGAAGCTCATTCGATAACGCGAATAATGCTCAGTTGGACCGATATACGCCGACGCCAAGCTGGCAGCTAATATAATGATGAA
CGCTGTCATCATTCCCTGGACGTGGTAGCTGTCGGATGCAAACAGTTGCTTTACAAGAAACACGACGACGGCAGGAAGCATGACCACGCTGGCAAGGGAT
CGCATTGCGATCAACAGGCATTGATCAGACTGCGAATAACGACTTGTTTTTAAAGCAGATAGTATCGCGGTATTTGGGGGCCAAAACCGCAGCATAACCT
GGTTATTGACAAACTCGCAGGATATTGACGGGTGGGCTCGAAAAATGAGAAACGCAAAGAATATCACGGCACCATAGGCTGCGATGGTGGCGCAAATGAT
GCCTAACTGTCGGCTTGCAATATTTTGATCTGCCTTAATCTTCTTGGCTACGTGATCGAAAATATCTTCGTTGACCTCGTCCTTCATCCAATAACCACTT
CCGAAGTAACACTCGAGGTTGAGTAACACCGCAAATGTTGGAAGACAATGACATGGCTGTTGCGACCCCGCTCCAAGCCATCAAAAAACTGCTTCTTTGT
CGAGGTGTGAGCGGCACATCGCTTAC
Protein section
ORF number : 4

 

ORF 1
LengthBeginEndStrandFusion ORF
387 bp128 aa84470+No
ORF function : Accessory Gene
AG : IS66 TnpA

ORF sequence :

METTLEVLTTRKSGREVHRHWPDDVKAQIVSESLRPGAMVSEVAERHGLKPNHLSTWRTMARQGKLLLPAPEDPMEFAAVIVDPPVSEPPIKKASRAEII
VGSVTIRLEEGASAARIAAVARACAAPA

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
354 bp117 aa467820+No
ORF function : Accessory Gene
AG : IS66 TnpB

ORF sequence :

MIFPSNRVRIMVATKPVDFRKGHDGLAALVKNELHKDPFTGTVFVFRSRKADRLKLIYWDGSGLVMAYKRLEEHTFTWPGIKDGLMTLGHAQFEALFAGL
DWRRVRAVEARAPDAIE

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1533 bp510 aa8892421+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLDTADFPDDIDALKTMLIAAQAREVRKDERIERLEKLVAAFKQAAFGRKSEKADPEQFDLALEDLETTIAAIHAEDEADTSSGKQRSKSRAVNRGSLLA
HLPRIEEIIEPESLICACGGCLHRIGEDVSERLDVIPAQFRVIVTRRPKYACRACTDGVAQAPAPARLIQAGLPTEATIAHVLVSKYADHLPLYRQAQIM
SRQGIDLDRSTLADWVGRAAFELRPVFDALIADLKRSTKLFMDETRAPVLDPGSRKTKTGYFWALARDDRPWSGGAPPGVAFTYAPGRGGQHAERILRGF
TGVLQVDGYAGYNRLIAPDRVGPDIRLAYCWAHARRKLVEITRTGTAPIAEEGVERIGELYRVESELRGLPAEARLAGRQERSAPLIADMRTWLTQHRAR
VAGKSSLGEALAYIAKYWDGLCVFLTDGRIEIDNNSIERTIRPIALNRKNALFAGHDMGARNWATIASLIETCKLNAVDPQAYLTSTLTAIVNGHKQNRI
DELLPWNHPV

 

Blast result :
ORF 4
LengthBeginEndStrandFusion ORF
627 bp208 aa31292503-No
ORF function : Passenger Gene
Annotation : Description :

ORF sequence :

 

Blast result :
Comments
ISRel8 is 76% (ORFA) aa similar to IS71, 73% (ORFB) to ISBj7 and 70% (ORFC : the transposase) to ISApr6. The fourth ORF is a passenger gene annotated as hypothetical protein.
References
1] González V, Santamaría RI, Bustos P, Hernández-González I, Medrano-Soto A, Moreno-Hagelsieb G, Janga SC, Ramírez MA, Jiménez-Jacinto V, Collado-Vides J, Dávila G. (2006) PNAS. 7;103(10):3834-9