ISRhba5

  • Family IS5
  • Group IS903
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_AAMT01000013 ND Rhodobacterales bacterium
Rhodobacterales bacterium HTCC2654
Pelagibaca bermudensis HTCC2601
Maritimibacter alkaliphilus HTCC2654
DNA section
IS Length : 1053 bp

Ends


IR Length : 15

IRL : GGCGTTGTTGCAGAACTCAGTCGGTGAAGGATTCACATCGGGAATCCATG
IRR : GGCGTTGTTGCAGAAAGTCGGCCTGAGTTGTGAGTGCCCCTTTCCCATTC

Insertion site


Left flankDirect repeatRight flankDR Length
TGATGCACTGCATCGCGCCC0

DNA sequence

GGCGTTGTTGCAGAACTCAGTCGGTGAAGGATTCACATCGGGAATCCATGCGGTTAGACGATCTGCATGAGCAAGCCCAAGCCCGCCCGCTACCGCACGA
CGAACTGGTCCAGCTACAACGATGCGCTCAGGAAGCGCGGATCGCTGCTGATCTGGCTGGACAAGGAGATGACCTGGCACGCGCCGCATGAGGGACGCCC
AGGGCGCCCGCCGGTCTTTTCGAATGCCGCGATCCAGTTTTGCCTGTCGCTCAAGGTTCTGTTCAAGCTACCGCTCAGGCAGACAGCCGGAATGGTCGCG
AGCCTCCTGCGCCTGGCAGGGCTAGACTGGCCCGTTCCGGACTACTCGACGCTGTGCCGCAGACAGAAGACCCTCAAGGTGCAGATCCCCTATCGCCGTG
CCGAAGGGCCGCTGAATCTTCTGGTGGACAGCACCGGCATCAAGTTTCTTGGCGACGGCGAATGGCAGGCCCGCAAGCATGGCGTTCAGGGCCGCCGCCA
ATGGCGCAAGGTGCATCTGGCGATGGATATCGCCACCTCGGATATCCGGGCCGTCGAGTTCACCCCTAGCCGGGAAGGCGACAGCCCAGTCCTGCCGGAC
CTGTTGGGCCAGATCCCCGAGGACGAGGACATCGGCACCGTGACCGCGGATGGTGCCTACGATACCCGCCGCTGCCACGGCGCCGTCATCGCACGCGGTG
GCACGGCAATCATACCGACCCGAAGGAACGGTCGAGCTTGGAAAGAGGACTGCCCGGCTGCCAAGGCGCGCAACGAAACCCTGCGCGCCACGCGTCACTA
CGGTCGGGCATTCTGGAAGCGGTGGACCGGATACCACGCCCGTAGCCGAGTGGAGGCCAAGATGCGATGCCTGAAGGCCTTCGGTGAGCGCATCGCCGCG
CGGGATCCAGATCGCCAAACCGCCGAAATCCACATCCGGGTCGCCCTTGTCAATCGCTTCAACGCGCTCGGCACCGCCCACGTCGTCCGCGTGGCATGAA
ACTGAATGGGAAAGGGGCACTCACAACTCAGGCCGACTTTCTGCAACAACGCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
933 bp310 aa67999+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSKPKPARYRTTNWSSYNDALRKRGSLLIWLDKEMTWHAPHEGRPGRPPVFSNAAIQFCLSLKVLFKLPLRQTAGMVASLLRLAGLDWPVPDYSTLCRRQ
KTLKVQIPYRRAEGPLNLLVDSTGIKFLGDGEWQARKHGVQGRRQWRKVHLAMDIATSDIRAVEFTPSREGDSPVLPDLLGQIPEDEDIGTVTADGAYDT
RRCHGAVIARGGTAIIPTRRNGRAWKEDCPAAKARNETLRATRHYGRAFWKRWTGYHARSRVEAKMRCLKAFGERIAARDPDRQTAEIHIRVALVNRFNA
LGTAHVVRVA

 

Blast result :
Comments
ISRhba5 is 93ù aa similar to ISPpa4.
References
1] ISfinder annotation (2010)
2] Giovannoni,S.J., Cho,J.-C., Ferriera,S., Johnson,J., Kravitz,S., Halpern,A., Remington,K., Beeson,K., Tran,B., Rogers,Y.-H., Friedman,R. and Venter,J.C. (2006) Direct submission GenBank.