ISRme6

  • Family IS5
  • Group IS427
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP000352 ND Ralstonia metallidurans
Ralstonia metallidurans CH34
Cupriavidus metallidurans CH34
DNA section
IS Length : 913 bp

Ends


IR Length : 19/22

IRL : GAGGCCAGTTCAAAAACCCCTGAGGCGGCTGTTTACTTTCTCGGTAAGCT
IRR : GAGGCCAGTTCAAAAAGGCTGCTCCGTACGCCTGAAGATGTTCCAGCAGA

Insertion site


Left flankDirect repeatRight flankDR Length
TCTTCATACTTAAAGGAAAATCT3

DNA sequence

GAGGCCAGTTCAAAAACCCCTGAGGCGGCTGTTTACTTTCTCGGTAAGCTGTTAACCTTGGATGTCTGAACAACGGAACCCAAGGGATGGAAGCGCCGAT
TATTGATGACGAATTGTGGACACTGATCGAACCGTTACTGCCGCCGCCCAAGCCCCGGCGCAAAGGGCATCCTGGTCGCCCACGCGTATCGGATCGGGCG
GCGTTGAATGGCATCCTGTTCGTGTTGAAAACCGGACTGCGATGGAACCACCTGCCGACCGTATTGGGCTTTGGCTCCGGCGCGACCTGCTGGCGACGAC
TGAACGACTGGCGCAAAGCAGGCGTATGGGATCGACTGCACGAACTGCTGCTCGACAAGTTGCGCGAGGCCGGGCAGATCGATCTTTCATACGCTGCCGT
CGATTCCTCGTCGGTACGAGCTGTTGGGGCGGGCGAAAAACTGGCCCGAACCCCACGGATCGCTCGCGACCCGGTTCCAAACACCACATCCTCGTAGACG
CCAATGGCGTTCCCATCAGCGCCATCCTGACAGGCGCGAACCGCAACGACGTCACCCAGTTGCTGCCGCTCGTCGACGCGATTCCCCCGATCCGTGGCGC
GCGCGGCCGACCACTTCAGAGACCCAAGGTCATCTATGCCGATCGTGGTTACGATTCCGATCCGCATCGTCAACGATTGCGCGAACGCGGCATCAAACCG
GTGATCGCACGGCGCCGCACTGAACATGGCAGTGGTCTGGGCAAATTCCGTTGGGTCGTTGAACGGACTCACTCGTGGCTCCACAACTTCCGTCGTCTTC
GCATACGCTTCGATCGTCGAGCTGACATTCACGAAGCATTCTTGAAATTCGGCTGCGCCCTCGTCTGCTGGAACATCTTCAGGCGTACGGAGCAGCCTTT
TTGAACTGGCCTC
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
411 bp136 aa87497+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MEAPIIDDELWTLIEPLLPPPKPRRKGHPGRPRVSDRAALNGILFVLKTGLRWNHLPTVLGFGSGATCWRRLNDWRKAGVWDRLHELLLDKLREAGQIDL
SYAAVDSSSVRAVGAGEKLARTPRIARDPVPNTTSS

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
579 bp192 aa326904+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

MGSTARTAARQVARGRADRSFIRCRRFLVGTSCWGGRKTGPNPTDRSRPGSKHHILVDANGVPISAILTGANRNDVTQLLPLVDAIPPIRGARGRPLQRP
KVIYADRGYDSDPHRQRLRERGIKPVIARRRTEHGSGLGKFRWVVERTHSWLHNFRRLRIRFDRRADIHEAFLKFGCALVCWNIFRRTEQPF

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
818 bp272 aa87904+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MEAPIIDDELWTLIEPLLPPPKPRRKGHPGRPRVSDRAALNGILFVLKTGLRWNHLPTVLGFGSGATCWRRLNDWRKAGVWDRLHELLLDKLREAGQIDL
SYAAVDSSSVRAVGAGEKTGPNPTDRSRPGSKHHILVDANGVPISAILTGANRNDVTQLLPLVDAIPPIRGARGRPLQRPKVIYADRGYDSDPHRQRLRE
RGIKPVIARRRTEHGSGLGKFRWVVERTHSWLHNFRRLRIRFDRRADIHEAFLKFGCALVCWNIFRRTEQPF

 

Blast result :
Comments
ISRme6 is 91% aa similar to ISBugl2.
The third ORF is a putative ORFAB transposase reconstructed in silico by a possible -1 frameshift.
References
1] Submitted by ISfinder (2010).
2] Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Martinez,M., Goltsman,E., Pitluck,S., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Kim,E., Mergeay,M., Benotmane,M.A., Vallaeys,T., Michaux,A., Monchy,S., Dunn,J., McCorkle,S., Taghavi,S., van der Lelie,D. and Richardson,P. (2006) Direct submission GenBank

3] Janssen,P.J., Van Houdt,R., Moors,H., Monsieurs,P., Morin,N., Benotmane,R., Lapidus,A., McCorkle,S., Monchy,S., Taghavi,S., van der Lelie,N., Dunn,J., Leys,N. and Mergeay,M. (2010) Direct submission GenBank