ISRba8

  • Family IS5
  • Group IS427
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_005027 ND Rhodopirellula baltica
Rhodopirellula baltica SH 1
DNA section
IS Length : 929 bp

Ends


IR Length : 15/16

IRL : GAGCCTATCCGGAAACCGTTTTTGATATTGAAAAGCAGGTGAGCCCCTTT
IRR : GAGCCTATCCGAAAACTCCGGCTCTGCTGAATGTGAAATAGGCGCATGCT

Insertion site


Left flankDirect repeatRight flankDR Length
TGCTCGCAACTAAATTCCTCGAT3

DNA sequence

GAGCCTATCCGGAAACCGTTTTTGATATTGAAAAGCAGGTGAGCCCCTTTGGTATTTGAGAGTTACCACACTTTCAACTACTCGCAGGGGACTCACCATG
GACGGTGCCACCAGCTTCGACCATTTCCGAATGTCTGATGAACTTTGGGAACAGATGAATGCCGTGCTTCCGATATACGAAGATTGCGGCAAGGGCGGTC
GCCCGAGAGCCAACCTTCGTGGCGTTGCCGATGCCATCTTCTATCGAATGCGTACTGGGTGTCAATGGAAAGCAATCCCGCGATGTCTCGCCGCGGGCAG
CACTGCTCACGCGTACTTTCAAGAGTGGGTGGGCTTCGGCGTTTTCGACGATCTATGGCAACTGGCATTAGAAGTCTATGACGAGTTGGTTGGCCTGGAT
TGGACATGGCAAAGTGTCGATGGGGCGATGACGAAAGCTCCGCTCGGTGGTGATGCAACGGGCAAAAACCCGACTGATCGAGGAAAACTCGGGACAAAAA
GATCGCTCATGACAGAAGCGGCAGGCATTCCGATTTCGCTCATCGTGGATGGAGCAAACACTCACGACATCAAGCTGTTGCAGGAAACGATTGAGCACTG
CCTTGTTCGTTGGCCTCGCGAACACAATGAATTTGATGAGCACATTTGTTTGGACAAAGGCTATCAGTCAGCCTCCATGCACACACTGATCGAAAGCGTC
TACCATTACACCGCACATGTGCGATCGCGTGCCGAAGAAAAACGCGAACTCAAGAGACAACGGGGTGAGCGTCCGAGACGCTGGGTAGTTGAACGAACAC
ACAGCTGGCTCAATCGGTTCCGAGCGGTCTTGGTACGCTGGGAGAAAAAGATCGACAACCATGTCGCTGCTCTACAACTAGCATGCGCCTATTTCACATT
CAGCAGAGCCGGAGTTTTCGGATAGGCTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
870 bp289 aa56925+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MRVTTLSTTRRGLTMDGATSFDHFRMSDELWEQMNAVLPIYEDCGKGGRPRANLRGVADAIFYRMRTGCQWKAIPRCLAAGSTAHAYFQEWVGFGVFDDL
WQLALEVYDELVGLDWTWQSVDGAMTKAPLGGDATGKNPTDRGKLGTKRSLMTEAAGIPISLIVDGANTHDIKLLQETIEHCLVRWPREHNEFDEHICLD
KGYQSASMHTLIESVYHYTAHVRSRAEEKRELKRQRGERPRRWVVERTHSWLNRFRAVLVRWEKKIDNHVAALQLACAYFTFSRAGVFG

 

Blast result :
Comments
ISRba8 is 71% aa similar to ISMac11.
References
1] Isfinder annotation (2010)
2] Gloeckner,F.O., Kube,M., Bauer,M., Teeling,H., Lombardot,T., Ludwig,W., Gade,D., Beck,A., Borzym,K., Heitmann,K., Rabus,R., Schlesner,H., Amann,R. and Reinhardt,R. (2003) Proc. Natl. Acad. Sci. U.S.A. 100 (14), 8298-8303.