ISHch3

  • Family IS5
  • Group IS427
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_007645 ND Hahella chejuensis
Hahella chejuensis KCTC 2396
DNA section
IS Length : 965 bp

Ends


IR Length : 18/19

IRL : GTAACTATCTCATAACCCCCACTTGAATTTTTTAACCTTTGCCGGTTCAC
IRR : GTAACTATCTCATAACCTCATTGACGCCCCTGTAGCCGCCACATCCGCCG

Insertion site


Left flankDirect repeatRight flankDR Length
ACTTATTGGTTAAGTCTGGCGTT3
CATCAACGGCTTAGCAGAAGACA3
TCTAATGGCTAAGTCGAAAGAT3
TCGTAGGGATTTAGTCCCACTTT3
ACTTTTGGGCTAAGCGTAAAAAA3

DNA sequence

GTAACTATCTCATAACCCCCACTTGAATTTTTTAACCTTTGCCGGTTCACTGAGGCGCCACTTCTCTGATAAGGAAACGTCATGTCACAAAAGGACTCAA
GCGCCCCGTCCAGTAAATCGAAACCCTGGACACTCTATGGGAAGTACCGGACGAGCTATGGCTACGAATCGAACCCATTTTAAAAGAAGACTGGCAACCC
AGCGCCAAGGGTGGCCGCCCCATCGGCAACTGGAGGGGCTATTTGAACGGGATTATTTTTCGGATGCGTTCAGGCTGTCAGTGGAACCAGTTGCCCCGCC
GATTTGGGGATGACGCCACGGTCCATCGCTGGTTTCAGCGCTGGAGTAAAAACGGCGTGATGGAGAAGATCTGGGCGAGTCTATTGCGAGACTGCCAGGA
ACTGGAAGGGGTGGACTGGGAATGGCAAAGTGCGGACGGCTGGCTGGGGAAAGCCCGCTTTGGGGGGGGAGAATGTGGGGCCGAACCCGACAGACCGAGG
CAAGAAGGGAACCAAGAAAAGCCTGCTGGTGGAAGCCGAGGGAGGCCCCTTGGGACTCGTCATCGCCGGAGCCAATGTCAACGACCATAAGCTGCTGGAA
GCGACGCTGGAGTCGATTGTGGTAGAGCGTCCGGCTCCAACGGTGGAGGCGCGGCAGCATTTATGCCTGGATAAGGGGTATGACAATGTGGCGAGCGAAG
ACGTGGCAGCCCGGCATGACTACATACCGCATATCTGCCGAATTGGCGAGGAGGCGCAGCCAGCGGACCGTCATCCAAGTGGAAAGCCCCGGCGTTGGGT
AGTGGAGCGCACGTTTGGTTGGCTGTCTAAGTGCCGTGCGTTACTGATTCGCTATGACAAAAAGGACAGCAACTATCTGGGATTGCTGCAATTGGCATGT
GGTCTGTTATGGTTTCGGCGGATGTGGCGGCTACAGGGGCGTCAATGAGGTTATGAGATAGTTAC
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
448 bp148 aa144591+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

VPDELWLRIEPILKEDWQPSAKGGRPIGNWRGYLNGIIFRMRSGCQWNQLPRRFGDDATVHRWFQRWSKNGVMEKIWASLLRDCQELEGVDWEWQSADGW
LGKARFGGGECGAEPDRPRQEGNQEKPAGGSRGRPLGTRHRRSQCQRP

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
588 bp195 aa361948+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

WRRSGRVYCETARNWKGWTGNGKVRTAGWGKPALGGENVGPNPTDRGKKGTKKSLLVEAEGGPLGLVIAGANVNDHKLLEATLESIVVERPAPTVEARQH
LCLDKGYDNVASEDVAARHDYIPHICRIGEEAQPADRHPSGKPRRWVVERTFGWLSKCRALLIRYDKKDSNYLGLLQLACGLLWFRRMWRLQGRQ

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
805 bp268 aa144948+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

VPDELWLRIEPILKEDWQPSAKGGRPIGNWRGYLNGIIFRMRSGCQWNQLPRRFGDDATVHRWFQRWSKNGVMEKIWASLLRDCQELEGVDWEWQSADGW
LGKKPALGGENVGPNPTDRGKKGTKKSLLVEAEGGPLGLVIAGANVNDHKLLEATLESIVVERPAPTVEARQHLCLDKGYDNVASEDVAARHDYIPHICR
IGEEAQPADRHPSGKPRRWVVERTFGWLSKCRALLIRYDKKDSNYLGLLQLACGLLWFRRMWRLQGRQ

 

Blast result :
Comments
ISHch3 is 60% aa similar to ISRba8.
The third ORF is a putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
References
1] ISfinder annotation (2010)
2] Jeong,H., Yim,J.H., Lee,C., Choi,S.H., Park,Y.K., Yoon,S.H., Hur,C.G., Kang,H.Y., Kim,D., Lee,H.H., Park,K.H., Park,S.H., Park,H.S., Lee,H.K., Oh,T.K. and Kim,J.F. (2005) Nucleic Acids Res. 33 (22), 7066-7073.