ISPfe1

  • Family IS3
  • Group IS407
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
HQ384168 Y Paracoccus ferrooxidans
Paracoccus ferrooxidans NCCB 100066
DNA section
IS Length : 1248 bp

Ends


IR Length : 19/22

IRL : TGACCTGCCCCCCGGAAGTTCCCTCGCTGTGATGTAGAGTCTGCCCAACC
IRR : TGACCTGCCCCCCGGTCGTCCCTCGTTCATAACGAGAGTCCTTGGGGTTG

Insertion site


Left flankDirect repeatRight flankDR Length
GATCGTAATCACCCGAGTGTGATC4

DNA sequence

TGACCTGCCCCCCGGAAGTTCCCTCGCTGTGATGTAGAGTCTGCCCAACCTGAGAAGGAGCAGACGACATGAGGAAAAGCCGGTTCACCGAGGCGCAGAT
TATCGGGATGATCAAGGAGCAGGAGGCGGGTTTGCCGACTTCCGAGCTTTGCCGGAAGCACGGGTTGAGCCCCGCGACGTTCTACAAGCTCAAGGCGAAG
TATGGCGGGATGGACCTGTCGGACGCCAAGCGGCTGAAGCAGCTCGAGGACGAGAACGCGAAGCTGAAGCGCCTTCTGGCCGATGCCATGCTGGACAACG
TGGTTCTGAAGGATCTCTTGGGAAAGCCCTGACGACACCGGTGCAACGGCGGGACGCGGTGCTGCGGGCGATGAAGGATCATCCGATCTCTCAGCGTCGG
GCCTGTGTCCTGATCGGTGTCGATCCGAAGACGGTGCGGCGTGACAGGCCACCCGACAACCCGGAAATCCGTGAGGAGATGCACAAGATTGCCGAGAAGC
GCCGGCGGTTCGGCTACCGGCGCGTGGGCATCCTGCTGGAGCGCAAGGGCATGATCATGAACGAGAAGAAGCTCTATCGCATCTACCGGGAAGAGGGCCT
GTCGGTGCGCCGCAGGCGTGGCCGCAAGAGGGCACGAGGTAGCCGGACGCCAATACCAGCGCCGTTGAGGCCAAACCAGCGGTGGTCGTTAGACTTCCTG
TCCGACACGTTCGGGGCCTGCCGCAAGTTCCGCATTCTGGCTGTGAACGACGATTGCTGCCGCGAGAACCTGGCGTTGATCGCTGACACGAGCATCTCTG
GGGCTCGGGTGGCACGGGAACTGGATGCGCTGGTCAGGATTTACGGCAAGCCCGCTTGCATCGTCAGCGACAACGGAACCGAGTTCACCAGCAAGGCCAT
CCTGAAATGGGCCAACGCGAACGGCGTCGAATGGCACTACATCGACCCGGGCAAGCCGCAGCAGAATGGCTACATCGAAAGCTTCAACGGCAGCCTGCGC
GACGAATGCCTGAACGAGGAAATCTTCGACAGCCTGGCTGATGCCCGCCGCAAACTGGCCCTCTGGCGCTACGACTACAACAACGTCAGGCCCCATTCCT
CGCTGGGCAACAAGACCCCGTCCGACGCGCGCCGAGCGCTTGAGCAATCTGAGGGCTCCGCGCCCGGCGCGCTTGCCACACCCGAAACCAACCAATATCA
ACCCCAAGGACTCTCGTTATGAACGAGGGACGACCGGGGGGCAGGTCA
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
264 bp87 aa69332+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MRKSRFTEAQIIGMIKEQEAGLPTSELCRKHGLSPATFYKLKAKYGGMDLSDAKRLKQLEDENAKLKRLLADAMLDNVVLKDLLGKP

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1074 bp357 aa1491222+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

LPEARVEPRDVLQAQGEVWRDGPVGRQAAEAARGREREAEAPSGRCHAGQRGSEGSLGKALTTPVQRRDAVLRAMKDHPISQRRACVLIGVDPKTVRRDR
PPDNPEIREEMHKIAEKRRRFGYRRVGILLERKGMIMNEKKLYRIYREEGLSVRRRRGRKRARGSRTPIPAPLRPNQRWSLDFLSDTFGACRKFRILAVN
DDCCRENLALIADTSISGARVARELDALVRIYGKPACIVSDNGTEFTSKAILKWANANGVEWHYIDPGKPQQNGYIESFNGSLRDECLNEEIFDSLADAR
RKLALWRYDYNNVRPHSSLGNKTPSDARRALEQSEGSAPGALATPETNQYQPQGLSL

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1154 bp384 aa691222+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MRKSRFTEAQIIGMIKEQEAGLPTSELCRKHGLSPATFYKLKAKYGGMDLSDAKRLKQLEDENAKLKRLLADAMLDNVVLKDLLGKALTTPVQRRDAVLR
AMKDHPISQRRACVLIGVDPKTVRRDRPPDNPEIREEMHKIAEKRRRFGYRRVGILLERKGMIMNEKKLYRIYREEGLSVRRRRGRKRARGSRTPIPAPL
RPNQRWSLDFLSDTFGACRKFRILAVNDDCCRENLALIADTSISGARVARELDALVRIYGKPACIVSDNGTEFTSKAILKWANANGVEWHYIDPGKPQQN
GYIESFNGSLRDECLNEEIFDSLADARRKLALWRYDYNNVRPHSSLGNKTPSDARRALEQSEGSAPGALATPETNQYQPQGLSL

 

Blast result :
Comments
ISPbe1 has been identified by its transposition into entrapment vector pCM132TC. ISPfe1 is 89% aa similar to ISRosp2. The third ORF is the putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
References
1] Dziewit, L., Baj, J., Szuplewska, M., Maj A., Tabin, M., Czyzkowska, A., Skrzypczyk, G., Adamczuk, M., Sitarek, T., Stawinski, P., Tudek, A., Wanasz, K., Wardal, E., Piechucka, E., Bartosik, D. (2012) PLoS ONE 7: e32277