ISEc36

  • Family IS3
  • Group IS2
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
JN412066 ND Escherichia coli
Escherichia coli W635
DNA section
IS Length : 1321 bp

Ends


IR Length : 28/37

IRL : TGGCCCCATGAATCTCCAGACAGTTGGTATCACTTAAGTTAGTGATAGTC
IRR : TGGCCCCTATATTTCCATACACTTTTTATCACTTAACCCATTACTGGTTC

Insertion site


Left flankDirect repeatRight flankDR Length
GGGACTGGATGTCTAATTCC0

DNA sequence

TGGCCCCATGAATCTCCAGACAGTTGGTATCACTTAAGTTAGTGATAGTCTTAATACTAGTTTTTAGACTATTCGTTGGAGTTCGGATGATTGATGTTTT
AGGTCCTGAGAAGGGCAGACGGCGCAGCGTTCAGGAAAAAATCGCCATTGTTCAGCAGAGTTTTGAACCCGGAATGACCGTGTCGCTGGTCGCCCGTCAG
CATGGTGTTGCTGCCAGTCAGCTGTTCCTGTGGCGTAAACAATATCAGGAAGGCAGCCTCACAGCCGTTGCCGCAGGAGAACAGGTTGTACCCGCGTCGG
AGCTGGCATCTGCGATGAAGCAAATTAAAGAGCTGCAGCGCCTGTTGGGCAAGAAAACCATGGAAAACGAGCTCCTAAAAGAAGCCGTTGAATATGGCCG
ACAAAAAAAGTGGATAGCGCACGTGCCCTTGTTGCCGGAGGATGGCGAATAAGCCTTGTCAGTCGTTGCCTCCGGGTCTCACGTGCGCAACTGCATGCCA
TGGCCCGTCGGTCGAAAGACTGGCAGGATCGTCGGTGCAAGCGCAAGCCTGATGATACTGACGCGCTGGCCCGTATCCATACCGTCATCGGCGATCTGCC
CACCTATGGTTATCGTCGGGTATGGGCACTGCTGCGCAGACAATCAGAAACTGACGACATGGCGGTGATCAATGCCAAACGCGTATACCGCATCATGCGT
CAGAATGCGCTGCTGCTTGAGCGTAAACCGGAAATACCGCTATCGAAGCGGGCGCATACAGGGAAAGTGGCCGTTGGAGAAAGTAACCAGCGGTGGTGCT
CTGACGGCTTCGAGTTCAGCTGTGATAACGGTGAAAAACTGCGGGTCACGTTCGCTCTGGACTGTTGCGATCGCGAGGCACTTCACTGGGCGGCCAGTAC
TGGTGGATATGACAGTGAAACCGTGCAGGACGTCATGCTGGGTGCCGTGGAGCGTCGCTTCGGTAACAGCCTGCCGACATCCCCCGTTGAGTGGCTGACA
GACAACGGTTCAGCCTACCGTTCTTATCAGACGCGTCAGTTCGCCAGAATGGTAGGACTGGAGCCTAAGCATACGGCGGTACGTAGCCCGGAAAGCAACG
GGATGGCAGAGAGCTTCGTGAAAACGATGAAGCGCGATTACATAAGTATCATGCCGAAACCCGACGGGTTAACAGCGGTAAAGAACCTCGCGGAGGCCTT
CGAACATTACAACGAATGGCATCCGCATAGTGCACTGGGGTATCGTTCGCCACGGGAATATCTGCGGCGACGAACCAGTAATGGGTTAAGTGATAAAAAG
TGTATGGAAATATAGGGGCCA
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
411 bp136 aa42452+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MIVLILVFRLFVGVRMIDVLGPEKGRRRSVQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTAVAAGEQVVPASELASAMKQIKELQR
LLGKKTMENELLKEAVEYGRQKKWIAHVPLLPEDGE

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
924 bp307 aa3921315+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

IWPTKKVDSARALVAGGWRISLVSRCLRVSRAQLHAMARRSKDWQDRRCKRKPDDTDALARIHTVIGDLPTYGYRRVWALLRRQSETDDMAVINAKRVYR
IMRQNALLLERKPEIPLSKRAHTGKVAVGESNQRWCSDGFEFSCDNGEKLRVTFALDCCDREALHWAASTGGYDSETVQDVMLGAVERRFGNSLPTSPVE
WLTDNGSAYRSYQTRQFARMVGLEPKHTAVRSPESNGMAESFVKTMKRDYISIMPKPDGLTAVKNLAEAFEHYNEWHPHSALGYRSPREYLRRRTSNGLS
DKKCMEI

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1274 bp424 aa421315+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MIVLILVFRLFVGVRMIDVLGPEKGRRRSVQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTAVAAGEQVVPASELASAMKQIKELQR
LLGKKTMENELLKEAVEYGRQKKVDSARALVAGGWRISLVSRCLRVSRAQLHAMARRSKDWQDRRCKRKPDDTDALARIHTVIGDLPTYGYRRVWALLRR
QSETDDMAVINAKRVYRIMRQNALLLERKPEIPLSKRAHTGKVAVGESNQRWCSDGFEFSCDNGEKLRVTFALDCCDREALHWAASTGGYDSETVQDVML
GAVERRFGNSLPTSPVEWLTDNGSAYRSYQTRQFARMVGLEPKHTAVRSPESNGMAESFVKTMKRDYISIMPKPDGLTAVKNLAEAFEHYNEWHPHSALG
YRSPREYLRRRTSNGLSDKKCMEI

 

Blast result :
Comments
ISEc36 is 91.2% (ORFA) and 98.9% (ORFB) aa similar to ISEc27. The third ORF is a putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
References
1] Beatriz Rojo-Bezares (2011) Direct submission
2] Rojo-Bezares B, Martín C, López M, Torres C, Sáenz Y. (2012) Antimicrob Agents Chemother. 56(2):1146-1147.