ISEc37

  • Family IS91
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
FJ914220 ND Escherichia coli
Escherichia coli 80 plasmid pECTm80
DNA section
IS Length : 1828 bp

Ends


oriIS : CGAGTAGGCAGCCTGACGGCTGCGGCTTGTCATGGTCTGCAATTACCGTTATAAAAACAGGCAATGTCATTGTCTTTCAGGTGGTTATATGGCCCGTTCA II struct. : No
terIS : TTTAATCGTCGGTTCCGTTCATATGAGCAAAAGTGGTGTTGAAGAAACATCCGTTTTGTGATGTTTTTTTAATCTTTTTGGGGTTTTAATTCCTATCGAT II struct. : No

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
TCGGACAGACGAACCGTTTT

DNA sequence

CGAGTAGGCAGCCTGACGGCTGCGGCTTGTCATGGTCTGCAATTACCGTTATAAAAACAGGCAATGTCATTGTCTTTCAGGTGGTTATATGGCCCGTTCA
GCTAAACCCCGTAAACGTAAACCCGCCTCTCAAAGAAGCAAACTTCCCCGCTATGTCGTGAAGCTTCACGAAGATGATTTTTTTGACGAAGAAGACGCAG
AAGTTCTGCGCTTTGATAGTTTTGACGATGCCGTTGAATGCTGAGCAGACCTGAATATTCCGTTCTTTGTGGATGCGGGAAACAAAAAGCTGGTCTTCTG
GTTTGTTCGTGTCGATGACGAAGGGTATCCGGAAATCGCCCGCTGTACGGAGCGGAAGTTTGCAACCATTCTTGCCGGTATCAGTGCCGGTGGTATGTAC
TGCCCGGAATGCGGCACAGTTCACTGGCCGGATGGCGTTACCCCACCCGTCTGATGCTTCCCCGTTTTGCCGATATTTTTCAGCAGGGTAACCGCTGGCT
TAACTGGCTGGAGAAACAGCCGGAAGGTTCAGTGCGTCCGGTGGTGACTGAGTCAGTGACAAAAATCATGGCATGCGGGACCACGCTGATGGGCTACACG
CAATGGTGCTGTTCATCACCGGACTGTTGCCACACAAAAAAGGTCTGCTTCCGGTGTAAAAGTCGCTCCTGCCCGCACTGCGGAGTGAAGGCTGGCGCAC
AGTGGATACAGTATCTGCTGAGTCTGCTCCCCGACTGCCCGTGGCAGCATATTGTGTTCACACTTCCCTGCCAGTACTGGCCCCTGGTGTTCCACAACAG
GTGGTTACTGGCAGAGATGAGCCGCATTGCTGCGGATGTGATACTGGAAATCTGCCGCCAGGCAGATGTGGAGCCGGGGATATTCATGGTGATCCACACA
TGGGGGCGTGACCAGCAGTGGCATCCGCATATCCATTTATCGACAACTGCCGGTGGTGTGACGTCGGGCCACACCTGGAAAAATCTTCATTTTTACGCCC
GTAAGGTGATGAGCATGTGGCGCTACCGGATAACACGGTTGCTGTCACGGAAATACCCTGACCTGGTGATGCCGGATGCGCTGGCAGCAGAAGGAAGCAG
TAAACGGGAATGGAATCGCTTCCTGGACACGCATTACCGCCGTGGCTGGAATGTCAACGTATCCCGGGTGATGGATAATGCCACCCATGTGGCGGTGTAC
TTTGGCTCTTACCTGAAAAAGCCACCGGTGCCGATGAGTCGTCTGGAGCATTATGCCGGTCAGGATGAAATCGGTCTGCGTTACAACAGTCACCGAACAA
AACGGGAAGAATACCTGTTGATGAGTGGAGATGAGTTCATGGAAAGGTTCTCCTGGCATGTGGCGGATAAGGGGTTCCGTATGGTGAGGTACTACGGTTT
TTTGAGTCCGGCGAAACGGCGGTTACTGGAAGAAGTGGTGTACATCATAACGGAGACAGTGAGAAAAACGGCGATGCAAATCACCTGGAGAGGGATGTAT
CAGAGGTTACTGAAGGTTGACCCGCTGAAGTGCGTGCTGTGCGGGAGTCAGATGCGTTTTACGGGGCTGAAGCGGGGCTACCGTCTGGCAGAGCTGGTCC
TGATGCATGAGCCGCTGGCCCGGATGCGGTGGTGCGGCTGAGAGCCGCAGAGGGTAAGTAGCGTCCATTTTGAGGGAAACGGAGCAAAAAACCGCCATTC
ATACCCTGAATCAATCAGAGCCATCCAGTTTAATCGTCGGTTCCGTTCATATGAGCAAAAGTGGTGTTGAAGAAACATCCGTTTTGTGATGTTTTTTTAA
TCTTTTTGGGGTTTTAATTCCTATCGAT
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1188 bp395 aa4541641+No
ORF function : Transposase
Chemistry : Y2

ORF sequence :

MLPRFADIFQQGNRWLNWLEKQPEGSVRPVVTESVTKIMACGTTLMGYTQWCCSSPDCCHTKKVCFRCKSRSCPHCGVKAGAQWIQYLLSLLPDCPWQHI
VFTLPCQYWPLVFHNRWLLAEMSRIAADVILEICRQADVEPGIFMVIHTWGRDQQWHPHIHLSTTAGGVTSGHTWKNLHFYARKVMSMWRYRITRLLSRK
YPDLVMPDALAAEGSSKREWNRFLDTHYRRGWNVNVSRVMDNATHVAVYFGSYLKKPPVPMSRLEHYAGQDEIGLRYNSHRTKREEYLLMSGDEFMERFS
WHVADKGFRMVRYYGFLSPAKRRLLEEVVYIITETVRKTAMQITWRGMYQRLLKVDPLKCVLCGSQMRFTGLKRGYRLAELVLMHEPLARMRWCG

 

Blast result :
Comments
IS91 is located on a 21.4 kilobase antibiotic resistance plasmid from an α hemolytic Escherichia coli O108:H- human clinical isolate.
ISEc37 is 97% aa similar to IS91.
References
1] Dawes, F.E. (2011) Direct submission
2]Dawes,F.E., Bulach,D.M., Kuzevski,A., Bettelheim,K.A., Djordjevic,S.P. and Walker,M.J. (2009) Direct submission to GenBank