ISHaha1

  • Family IS4
  • Group IS231
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
HE717023 ND Halobacillus halophilus
Halobacillus halophilus DSM 2266
DNA section
IS Length : 1554 bp

Ends


IR Length : 15/16

IRL : CATACCCGTCAAGCTAAGCTCTATAATTTCGTAACTCCCTTATAAACGTT
IRR : CATATCCGTCAAGCTAGTAAGTGAATAATTCTAGATAAGCAGTGGTCCAA

Insertion site


Left flankDirect repeatRight flankDR Length
ATGGGAGTCTCGTCATTTCCCACCACCCCA11
TGGGTTGGTGGGGAAATGGCGAGACTCCCCG11
GGGGTTGGTGGGGAAATGACGAGACTCCCAT11
ATGGGAGTCTCGCCATTTCCCCACCAACCCA11

DNA sequence

CATACCCGTCAAGCTAAGCTCTATAATTTCGTAACTCCCTTATAAACGTTACTCTTTTAGATGAAATTTCTAAAGGAGGATAATTTTATGGATCTTAGTA
AACACCTTCGGTCTATGGCTCAAGCTATTACAGAAACTTTAGGAGATCATTCTCTACGACAAACAGCTAAAGAAACGGGATTTTTGAAACGGACCAGTAA
ACTTAAACCAGAAGCATTCTTAAGTTTATGCACCCTCTTAAAAGATTCCGTGGGCAAAAACACCTTACCTAACTTATGTAGCCAAATCTCCTACGAATTC
CATACTTTTATCTCTAAACAAGCTTTGCATGAACGTTTTAACGATAAAGCGGTTTCCTTTCTAAAACAAGTATATAAGCAATTAGCCGATAAGCAGGAAA
TAACTTCGTCGGTTTTGGAACATCATTCATTATTCTCGCGCCTTAGAATTATGGATGCGACATCTTTTCGTCTGCCCAGCTCTTACTCCGATTATCCAGG
AGTACAGGGGCATGGAGTTAAAGTACAACTAGAATATGAATGGCTCAGGGGCAAGTTACTCTACCATAAGATTCAAGCAGAAGCTAAAAGTGATAAAGAT
GCCGCACGTGATCAGATGGAGTCATTGGAACCAGGGGATCTACTGTTACGGGATTTAGGTTATTATTCGGCAAGATTAATAAAGGAGATGGAGAGTAAAG
GGGCATTTTTCATTAGCAGAGTGCCGAGCCAAACCAAGTTTTGGACCGGGAGTTCGAAAGAAGGTTGGATACAAATTAAGCCTGAGGAAGATCTGAAACA
TAAGGTTTCGGGAGAAACCATTGATTATGGATTCATAAAAGTGGGAGGAGATTCACGAAGTTCCTATGTGGCTCGCATTGTAGCTCAGAAGCTTACGCTT
CAACAACAAAAGCAACGGGAAAGAGCGTTACATTTAAAAAGGCAGAAAGGTCACCAGACCCTTTCTGCCAATCAAAGAACTCAAATTCAAATCCTTGTGA
CCAATGTAACACAGGAAGATTTGGCCGCTCAAGACCTTTACCCTTTGTATTCCATAAGGTGGCAGGTAGAGATCTTATTTAAAGCTTGGAAATCCCTATT
TGAAATGGATGATGTCCGAAAAATAAATCAAGATCGATTGGAATGTCATTTATATGGAACGTTAATTGAGATTCTTCTCTCTTCCATGGTGACTTTCCAG
TGTCGTCACTATTTATATTGGAAACACCGAATAGAAGCAAGTGAATATAAGTGCATGGATATCGTGAAACAGGCTTTGCCATATCTAGTGTCTCCAATAA
AATCTGATTCGAAGAGTGTCGTAAAGATATTAGAAGCTATCTTCGAAAACGCTAGGCGACACGGCAGGAAAGACCACAAAGAAAAACATGAAAGTCCGTT
CGATGTTTTAGGATTAACTTATAAATAAAAGATTCCCTTCTTTTTATTACTGACTCCTTTAGGAGTCAATATAACCTTGATTGGAAATATGTGTAATTGA
AGGATTGGACCACTGCTTATCTAGAATTATTCACTTACTAGCTTGACGGATATG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1341 bp446 aa881428+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MDLSKHLRSMAQAITETLGDHSLRQTAKETGFLKRTSKLKPEAFLSLCTLLKDSVGKNTLPNLCSQISYEFHTFISKQALHERFNDKAVSFLKQVYKQLA
DKQEITSSVLEHHSLFSRLRIMDATSFRLPSSYSDYPGVQGHGVKVQLEYEWLRGKLLYHKIQAEAKSDKDAARDQMESLEPGDLLLRDLGYYSARLIKE
MESKGAFFISRVPSQTKFWTGSSKEGWIQIKPEEDLKHKVSGETIDYGFIKVGGDSRSSYVARIVAQKLTLQQQKQRERALHLKRQKGHQTLSANQRTQI
QILVTNVTQEDLAAQDLYPLYSIRWQVEILFKAWKSLFEMDDVRKINQDRLECHLYGTLIEILLSSMVTFQCRHYLYWKHRIEASEYKCMDIVKQALPYL
VSPIKSDSKSVVKILEAIFENARRHGRKDHKEKHESPFDVLGLTYK

 

Blast result :
Comments
ISHaha1 is 56% aa simialar to ISBce4.
References
1] Saum S.H., Pfeiffer F., Palm P., Rampp M., Schuster S.C., Müller V., and Oesterhelt D. (2013) Environ. Microbiol. 15 (5), 1619-1633.