ISHaha2

  • Family ISL3
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
HE717023 ND Halobacillus halophilus
Halobacillus halophilus DSM 2266
DNA section
IS Length : 1376 bp

Ends


IR Length : 19/25

IRL : GGCTCTAGAATATTTGTTGGGGTAGATAAAAAATTTGGTATAAAAAAACA
IRR : GGTTCTAAGTCAATTGTTGGGGTAGGAGGCAAGCTCCTGCCCCTTAACCA

Insertion site


Left flankDirect repeatRight flankDR Length
AGCCTCTCTATTTTTTTGTGAGGAAT8
CTTTTTTTCATTTTTTTATTAATCCA8
ATATCTAAAATTTTTGTTTCCTTCAT8

DNA sequence

GGCTCTAGAATATTTGTTGGGGTAGATAAAAAATTTGGTATAAAAAAACACGCAAGCTCCAATCTTTACTACACTTGAATTGTCGAGAAACAAGCAGTAA
AGGAGTTGCGTGTACGTGTATTCTAACATGCCCATACCAGGACTACAAAAGGCGATAATAAAGAAAAGTGAAGAAGTAGAAGGGGGATTTCATCTTCATG
TGGAATTGCCGAGAAAGAATCACAGGTGTAAGGATTGCGGAGAATGGACCGATCGCATCCACGACTACAGAATACAGAAAATCCAACACCTTAAAATCTT
TGAACGTACCACCTCCCTCTTCTACCGAAAACGTCGTTACCGTTGTAGGTGCGGGAAACGATTTTTTGAAGATAACGACCTGGTTGAGCGGTATCAGCGT
CACTCGAAGGAGTGGAACCAGGCCTTAGGCCTTCGAGTCATTCAGGGAAAGAACTTCAAAGATACAGCTGACTTATTTCGTACTTCTCCAACCACAGTTA
TGCGCCGCTTTGATGAGTTGGCCATGCCTATGTTGGAGAAGGTGGAAACCCTTCCGCCTGTGATTGCGATTGATGAATACAAAGGAGATACGAGTGCAGG
AAAGTACCAAGTCGTCATTGCCGACGGAGACACCGGTCAACTCTTGGATATTCTTCCGGATCGTTCCGTGGATACCGTGCGAGATTATCTTCGCGAGAAG
GGATCGGAGGTCGAGATGGTGATTATGGATATGAGTCACGCCTTCAAATCGGCCGTCCAAAAAGCCTTGGGCAGCCCTATCATTGTGGCTGATCGTTTTC
ACTTCTGTCGCTACATCTACTGGGCTCTCGAACGAGTGAGAAGGCGTGTTCAGAAAGAATTTCATCATTACGATAGGAAGCAGTGTAAGCGAAAAAAGCA
TGTCTTTTATAAGCGTGAAGAGAACTTAACGGAAAGGCAACGCTGGCATCTAGAACGCTACCTAAGCATGTCGGAAGACATGCGTACCTCCTATGAATTG
AAGGAATCTTTTAGAGAATGGTTTGAGAGAGCGAAGAACATTGGAGTTGAACAACCGTCTCAGGTTAAGAAAGAGTTACATAACTTCTATAAGCAGGTAG
AAAAAGCAGGTGTATGGGAGTTTATGCAGGGGATTAATACTTTGAAGAATTGGCAGAAAGAAATCTTGAATAGCTTTACTTTCAATTATAGCAATGGATT
CGTGGAGGGACTAAACAATCAGACGAAGGTTATTAAACGAAATGCCTTTGGTTTCAGGAGATATGATCGTCTTCGATTGAAGGTCCTCCTTCATCATCAA
TACAAACATATAAGAAATTTTCAAGTTGGTTAAGGGGCAGGAGCTTGCCTCCTACCCCAACAATTGACTTAGAACC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1224 bp407 aa1101333+No
ORF function : Transposase
Chemistry : Unknow

ORF sequence :

MYVYSNMPIPGLQKAIIKKSEEVEGGFHLHVELPRKNHRCKDCGEWTDRIHDYRIQKIQHLKIFERTTSLFYRKRRYRCRCGKRFFEDNDLVERYQRHSK
EWNQALGLRVIQGKNFKDTADLFRTSPTTVMRRFDELAMPMLEKVETLPPVIAIDEYKGDTSAGKYQVVIADGDTGQLLDILPDRSVDTVRDYLREKGSE
VEMVIMDMSHAFKSAVQKALGSPIIVADRFHFCRYIYWALERVRRRVQKEFHHYDRKQCKRKKHVFYKREENLTERQRWHLERYLSMSEDMRTSYELKES
FREWFERAKNIGVEQPSQVKKELHNFYKQVEKAGVWEFMQGINTLKNWQKEILNSFTFNYSNGFVEGLNNQTKVIKRNAFGFRRYDRLRLKVLLHHQYKH
IRNFQVG

 

Blast result :
Comments
ISHaha2 is 78% aa similar to IS651.
References
1] Saum S.H., Pfeiffer F., Palm P., Rampp M., Schuster S.C., Müller V., and Oesterhelt D. (2013) Environ. Microbiol. 15 (5), 1619-1633.