ISHaha5

  • Family IS110
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
HE717023 ND Halobacillus halophilus
Halobacillus halophilus DSM 2266
DNA section
IS Length : 1627 bp

Ends


Left end : TTCGTATTATAAGGTTAACCAGAATTCTAGATATTTCTGGTTGACCATTTTTAATATGGTCTTATTATTACAGTAGCCAGGGTAGAACGCCCCTGCCCGT
Right end : TCAAACATTTGAGGAAGGTTATTTGCCATGCGCATTTTTAGTATAACATGGGTTACCTTAAGTTTTTATTGAAAAATGTTGACAAACTATTAGCTGGTTT

Insertion site


Left flankDirect repeatRight flankDR Length
ATCCGGCCCTAGCTGAAGAT0
ATCCGGCCCGGGTTGAATAA0
TAACCTGCCCACTTGAAGAC0

DNA sequence

TTCGTATTATAAGGTTAACCAGAATTCTAGATATTTCTGGTTGACCATTTTTAATATGGTCTTATTATTACAGTAGCCAGGGTAGAACGCCCCTGCCCGT
GGGACTTAGATCCCGTCAGCTAAACCGTTCACCCCCTACTGGTAGAAACATGTTTGAGGCTGGTTGGGACAAGATCCCGTATAACAAGCGAAGCTATGAT
ACTACTAGGAGGACTAGGGGTTACTGGCAAGATGAATCTGAGGAGGAGATATAGAATGAATCCAGTCGTGGGTCTGGATGTTTCAAAAGGAGAAAGTGAG
GTTCAGGCCTTTTTAGATAAAGGAAAACCTTACGGTAAAAGTTTTAGCATCAAGCATGACCTGGATGGACTAGGCTCACTACTTGAGTTTATGGAAGGTG
TAAAAGATGCAACAGGCATTCAACCTTCGGTTGTACTAGAAGCTACTGGACACTATCACGCACCAGTGGTGCAGTTTCTGGAGCAACATAACTATTTATT
GATTATTGTTAACCCTTTGATCTCTCATAGAGCTAAAAGCTCAAGTTTACGAAAAGTTAAAACGGATGCCATTGATGCTTATCGTCTTTGTGAGCTTTAC
TACAAAGAAGATTTAGAACCTTATAAAAGACGCGGTACTCAGCTTTTAAACTTGCGTAATCTTACAAGGCAACACGAGAATATTACGGGAATTTATGTGC
AAACCAAATTACAATTTCAAGCAGTACTGGATCAAATATTCCCTGAATATAAAGGGGTTTTTGGTGACTTATACTCAGTGGTGTCTTTACTTGTGTTAAA
GGAATTCCCTTCATCAGAAGACATTTTAGCTGTTAGCCAAGATGCGTTAGCTGATAAAATCAAGGAATTCTGTAAGAGTCGGTCTAAGAGATGGGCAGCG
GAAAAAGCTCAGGAACTTAAGAAAGCAGCTGCACGGAACCCATTCAAAAAGACACTTTATCAGAGTCATTTACTGAGTCTTGGTATGTATATCAATATGC
TTCTTCAATACAAAGAGCATCTATCCAGATTGGACTCAGAGATAGATGCTCTCGCAAAAGAAGTTGAAGAATATAAGATCATCCAATCTATCCCTGGTAT
TGGAGAAAAAATCGCTGCCACGATTATTTCTGAGATTGGGGAGATAGACCGGTTTAATCACCCTAAAAAGCTAGTAGCATTCGCAGGAGTTGATCCAGAA
GTACATGAATCAGGTAAGTTTAAGGCGACTTTAGTTCGGATTACAAAACGTGGTTCAAGCCGACTACGTCATGCCCTATATATGGCCGTTAGATCTGGTA
TTCGTGATTGTCGCAAACAAAAAACAACAGCCGAAATTATCCCTAGAAACAGAAAATTAAGAGCGTTTTACGACAAGAAGCGAAAGGAAGGCAAATTATA
TAAAGTAGCCGTCATTGCTTGTGTAAATAAGCTCTTACATTGGATTTATGCTTTATTAAAAAACAAAACCACTTTCCAAGATATAGCGTAATCACTATTT
CCATCTAAATAATACAAAACCTTCCAATCAAACATTTGAGGAAGGTTATTTGCCATGCGCATTTTTAGTATAACATGGGTTACCTTAAGTTTTTATTGAA
AAATGTTGACAAACTATTAGCTGGTTT
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1236 bp411 aa2561491+No
ORF function : Transposase
Chemistry : DEDD

ORF sequence :

MNPVVGLDVSKGESEVQAFLDKGKPYGKSFSIKHDLDGLGSLLEFMEGVKDATGIQPSVVLEATGHYHAPVVQFLEQHNYLLIIVNPLISHRAKSSSLRK
VKTDAIDAYRLCELYYKEDLEPYKRRGTQLLNLRNLTRQHENITGIYVQTKLQFQAVLDQIFPEYKGVFGDLYSVVSLLVLKEFPSSEDILAVSQDALAD
KIKEFCKSRSKRWAAEKAQELKKAAARNPFKKTLYQSHLLSLGMYINMLLQYKEHLSRLDSEIDALAKEVEEYKIIQSIPGIGEKIAATIISEIGEIDRF
NHPKKLVAFAGVDPEVHESGKFKATLVRITKRGSSRLRHALYMAVRSGIRDCRKQKTTAEIIPRNRKLRAFYDKKRKEGKLYKVAVIACVNKLLHWIYAL
LKNKTTFQDIA

 

Blast result :
Comments
ISHaha5 is 52% aa similar to ISBth13.
References
1] Saum S.H., Pfeiffer F., Palm P., Rampp M., Schuster S.C., Müller V., and Oesterhelt D. (2013) Environ. Microbiol. 15 (5), 1619-1633.