ISHaha3

  • Family IS3
  • Group IS150
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
HE717023 ND Halobacillus halophilus
Halobacillus halophilus DSM 2266
DNA section
IS Length : 1437 bp

Ends


IR Length : 22/29

IRL : TGTAATGACCCCCAAATGTTGGACACCTTATGAAACTTAGGAGGGACCCA
IRR : TGAACTGACCCCTTAAAATTGGACACATTCATTAAAATTATCACGCCGAT

Insertion site


Left flankDirect repeatRight flankDR Length
CGGAAGTCGAAGACTGAGGAGGC3
GCCTCCTCAGTCTTCGACTTCCG3
CCTCAGTCGTTTCACTCCTTGCG3
GCCTCCTCGAGCAAGCTCTGCGGG4
TCCTCAGTCGCTTCACTCCCTGT3
GCCTCCTCAGTCTTCGACTTCCGG4
CGGAAGGCTTTAGCCTGAGGAGGC4

DNA sequence

TGTAATGACCCCCAAATGTTGGACACCTTATGAAACTTAGGAGGGACCCAACATATGTCTAAACTTACTTCTCAAGAAAAGTACCTGATCGTCCAACGTT
ATCTCACGGAAAATGTCAGTTTCCGTGACTTAGAAAAAGAGTTTGGAGTGGATAGTTCTTCCATCCGTTATTGGGTGAAATTATCCGAATATCATGGTAG
TGAAGCCTTCGACTTCCCCTATACAAACTATTCAGCTGCCTTTAAACTGAAAGTAATTCAACGTATAGAGGAAGAAGAATATTCGATTCGAGAAGCTTCC
GCTATGTTTCACATCCCCGATTTCTCCATGGTACGCCGATGGCGTAAGAAGTGGCTGGAAGGCGGAAAAGAAGCCCTTGAATCTACAAGGAAGGGGCCAA
CACAGATGACGTCTCATAAGAAGAAAGAAGATTCAATGGATTCTTATGAAGCCTTAAAGAAAGAGAATGAACGCTTACGGATGGAAAATGAATACTTAAA
AAAGTTAGAGACCTTAGCTCAAAAAAAGAAAGCATCTCGAAAGAAGAACAAGCGCAAGTAATCGATGAGTTAAGGTTTCATTTTCCAGTTAAACAGCTGA
CGGAAATAGCTGATATCCCTAGAAGTACCTATTACCATTGGAAAGAAAAGCAACTCGAGCCAAAAACGGACCGACCATTAAAGGAGCTTATCACCTCCAT
TTTTAAAGAACATAAAGGTCGCTACGGCTATCGCCGCATTGAAAATGAGCTTCGTAATCTAGGTCATGAAGTGAACCATAAAAAAGTCTATCGTCTTATG
AAAGAACTGGGGCTTCAGTCTACGGTGAAAATGAAGAAATATCGTTCTTATAAAGGGAAAGTTGGTCAAACGGCTCCAAACATCTTAAATCGGAATTTCA
AGGCGGATCAGCCGAATCAGAAATGGGTGACAGACATTACGGAGTTCAAGCTATTTGGCGAGAAGCTTTATCTTTCCCCTGTCTTAGATCTATTCAATGG
AGAAATCATCACGTACACAATTGGTTCCAGACCCACCTATTCCTTGGTGAACAACATGTTAGACCAAGCATTTGAACGCCTTCATCCATCGGATGAACTG
GTTATGCACTCCGACCAGGGATGGCATTACCAAATGGCTCCCTATCGAAAGAAATTGAAAGACCATCAAGTTACCCAAAGCATGTCCAGAAAAGGGAATT
GTCATGATAACGCCGTTATGGAGAACTTTTTCGGTATCATGAAATCGGAATTCCTTTATTTAAGAGAATTTGAAAGTGTGGCCCATTTCAAACAAGAATT
AGAGGAATATATCCATTATTATAATCATAAACGCATCAAATCGAAGCTCAGAATAAGCCCCATTTCCTATCGAGCCCGCTTTCAAGAATCGGCGTGATAA
TTTTAATGAATGTGTCCAATTTTAAGGGGTCAGTTCA
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
507 bp168 aa55561+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MSKLTSQEKYLIVQRYLTENVSFRDLEKEFGVDSSSIRYWVKLSEYHGSEAFDFPYTNYSAAFKLKVIQRIEEEEYSIREASAMFHIPDFSMVRRWRKKW
LEGGKEALESTRKGPTQMTSHKKKEDSMDSYEALKKENERLRMENEYLKKLETLAQKKKASRKKNKRK

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
906 bp301 aa4921397+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

ILKKVRDLSSKKESISKEEQAQVIDELRFHFPVKQLTEIADIPRSTYYHWKEKQLEPKTDRPLKELITSIFKEHKGRYGYRRIENELRNLGHEVNHKKVY
RLMKELGLQSTVKMKKYRSYKGKVGQTAPNILNRNFKADQPNQKWVTDITEFKLFGEKLYLSPVLDLFNGEIITYTIGSRPTYSLVNNMLDQAFERLHPS
DELVMHSDQGWHYQMAPYRKKLKDHQVTQSMSRKGNCHDNAVMENFFGIMKSEFLYLREFESVAHFKQELEEYIHYYNHKRIKSKLRISPISYRARFQES
A

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1343 bp447 aa551397+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSKLTSQEKYLIVQRYLTENVSFRDLEKEFGVDSSSIRYWVKLSEYHGSEAFDFPYTNYSAAFKLKVIQRIEEEEYSIREASAMFHIPDFSMVRRWRKKW
LEGGKEALESTRKGPTQMTSHKKKEDSMDSYEALKKENERLRMENEYLKKVRDLSSKKESISKEEQAQVIDELRFHFPVKQLTEIADIPRSTYYHWKEKQ
LEPKTDRPLKELITSIFKEHKGRYGYRRIENELRNLGHEVNHKKVYRLMKELGLQSTVKMKKYRSYKGKVGQTAPNILNRNFKADQPNQKWVTDITEFKL
FGEKLYLSPVLDLFNGEIITYTIGSRPTYSLVNNMLDQAFERLHPSDELVMHSDQGWHYQMAPYRKKLKDHQVTQSMSRKGNCHDNAVMENFFGIMKSEF
LYLREFESVAHFKQELEEYIHYYNHKRIKSKLRISPISYRARFQESA

 

Blast result :
Comments
ISHaha3 is 76% aa similar to ISBth10.
The third ORF is a ORFAB transposase reconstructed to represent a probable -1 ribosome slippage.
References
1] Saum S.H., Pfeiffer F., Palm P., Rampp M., Schuster S.C., Müller V., and Oesterhelt D. (2013) Environ. Microbiol. 15 (5), 1619-1633.