ISHvo3

  • Family IS5
  • Group ISH1
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP001955 ND Haloferax volcanii
Haloquadratum walsbyi
Haloferax volcanii DS2 plasmid pHV4
DNA section
IS Length : 941 bp

Ends


IR Length : 23/29

IRL : GGCTCTGTTGAATCACTAGACAGCGTCGGGATGGGTCGCTAAATCAAAGG
IRR : GGCTGTGTTGAATCGCCATACGGCGTAGGTTTTTCACTGTTTCACGGCAC

Insertion site


Left flankDirect repeatRight flankDR Length
TCACATCTAACTCTGCAAACGCATCCTGGGAC8

DNA sequence

GGCTCTGTTGAATCACTAGACAGCGTCGGGATGGGTCGCTAAATCAAAGGAATTGAAGCGGGAGACTGCGAATGTACATGACGCAAATCTCTCGCTTCAC
TAGCGAGATTGTCCCGATTTCTCAAAGAGTTACTGGTGATGGAGACGAATCCGCCGCCCCACAAGGTGGCGGCGGATTCGCTGACTACGCGCTCGTTTCC
CTCCATTGTCTACGGATTTACCTCAACACGTCCTACCGGATGACGATTGACCTACTGAAGGAGATGCCACAAATAACCGGGGAGATCGGCCTCGACACGG
CCGATCTCCCCTCGCCATCCACGTTGTGTAAAGCGTTCGACCGGATCAGCATGAGCGTCTGCCGAGTGCTGCTGCGCCAGTCGGCGCAGCTGCACGACCC
CTCGAAACACGGTGCAATCGACGCCACGTTCTACGAACGATCAGCTGCGAGCCGTCACTACTGCCAGCGAACAAGCTACCGCGTCCAGAAGCTCAAAGTG
ACGAAGCTCGTCGATACAGACTCTCAAGCCGTTCTTGACGTACACTGTTCGACGAACCGGAAAGGAAGTGACGCCGACCTTGCCGAGCAGATCGCCCGCC
GGAACGCGGGCGATCTGCGGTCTCTTGCCGCCGACAAGGGATACGACAAGAAATCGCTCCGCGAATCCCTTCGTAACCTCGGGATTCGCCCACTCATCAA
ACATCGCATCTTCGCTCCCTATGATCACGCGCACAACGCCAGAATCGACGAACAGCGCTACAATCAGCGCTCTATGTCTGAGACCGTGAACTCGGCGGTC
AAGCGCTCGCTCGGCTTCGCCGTGCGAGCGCGTACTTGGTTCCGTGAGTTCCGGGAAATAGCTCTGATGTGTGTCGTTTACAACATTAAGCGTGCCGTGA
AACAGTGAAAAACCTACGCCGTATGGCGATTCAACACAGCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
831 bp276 aa78908+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MTQISRFTSEIVPISQRVTGDGDESAAPQGGGGFADYALVSLHCLRIYLNTSYRMTIDLLKEMPQITGEIGLDTADLPSPSTLCKAFDRISMSVCRVLLR
QSAQLHDPSKHGAIDATFYERSAASRHYCQRTSYRVQKLKVTKLVDTDSQAVLDVHCSTNRKGSDADLAEQIARRNAGDLRSLAADKGYDKKSLRESLRN
LGIRPLIKHRIFAPYDHAHNARIDEQRYNQRSMSETVNSAVKRSLGFAVRARTWFREFREIALMCVVYNIKRAVKQ

 

Blast result :
Comments
ISHvo3 is 98% aa similar to ISHwa3.
References
1] Hartman, A.L., Norais, C., Badger, J.H., Delmas, S., Haldenby, S., Madupu, R., Robinson, J., Khouri, H., Ren, Q., Lowe, T.M., Maupin-Furlow, J., Pohlschroder, M., Daniels, C., Pfeiffer, F.,
Allers, T., Eisen, J.A. (2010) PLoS ONE 5, E9605-E9605