ISDku1

  • Family IS256
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_015573 ND Desulfotomaculum kuznetsovii
Desulfotomaculum kuznetsovii DSM 6115
DNA section
IS Length : 1486 bp

Ends


IR Length : 23/28

IRL : GAGAACGTAAAAAGTTTTGTGTAAATGGTTAAACTTAACGCAAAAGGAGA
IRR : GGGAGTGTAAATAATTTTGTGTAAATGGAAATTCCTCCGAAAAACTGGTT

Insertion site


Left flankDirect repeatRight flankDR Length
GATGCGCCCGCTATAGCTCTCATCCACC8

DNA sequence

GAGAACGTAAAAAGTTTTGTGTAAATGGTTAAACTTAACGCAAAAGGAGATGACCATTTATGCAAGACTTGAAGGACAAAACCATTAGGGAACTGGCGAA
GGGCTGCCGAACTGTCGATGATGTTCATGAGATGCTCAAGAGTTTATTCAAGGACACCATACAGCAGATACTTGAAGCTGAGATGGAAGAGCACCTTGGA
TACAAGAAACACAGCCCAGAAGGAAATAATACAGGCAACAGCCGAAACGGCTACAGTAAGAAAACCATCAAGACCAGGTTTGGCGAAACCGAAATCTCTG
TTCCTAGAGACCGTAACGGTGAATTTGAACCCAGGATTGTTAGGAAATACGAGACAACCTCCAACCAACTGGAGGAACAAATTATTGCCATGTACGCAAA
AGGTATGTCCACTCGTGATATCGAAGAACACATGCGGGACATTTACGGGATCGATATTTCGCCAACCATGGTCAGCAAGATAACCGACAAAATTCTGCCC
ATGATTTCTGAGTGGCAGTCAAGACCGTTAGAGCGGATTTACCCTGTGGTCTTTCTCGATGCTATCCACTTCAAAGTTCGCAAAGACGGCAGAATTGTTA
ATAAGGCCGCCTACAGCGTACTGGGCATCAATATGGCCGGCCAGAAAGAAGTCCTGGGCATCTGGGTTGGGGAACACGAAAGCGCCAGTTTCTGGCTCAG
TGTCTGCAATGACTTGAAAAACAGAGGCGTTCAAGACATTCTGATTGCCTGTAAAGACGGCCTTTCGGGTTTTTCCGAAGCCATTAATACGGTGTTTCCC
AAAACAGAGATCCAATTATGCGTCATTCATCAAATACGAAACTCCCTGAAATATGTGCCTTACAAAGAGCAAAAGGAGTTTATGGCTGACTTAAAGAAAG
TGTATCAGGCTTTAACAATTGAAGAAGCGGAATTGGCCTTTACCGCCTTTAAAGAAAAATGGGGCAAAAGACATCCCATCATTATAAGGTCGTGGGAAAA
CAACTGGCTCGAATTAACGGCTTACTTTAAATATCCTCACGAAATACGCCGCTTAATCTACACAACCAACGTCATTGAGGGTTATCACAGGCAGTTACGT
AAAGTAACCAAGACAAAAACAGCTTATCCGACTGATGAGGCCCTTGTTAAACTAATATACCTTGCTACCATCGAAGCATCCAAAAAATGGACAATGCCCA
TCAGAGAGTGGAAAAAATGCATGTCTCAATTTGCAATTTACTTTGAAGACAGGTTAGAATCAGAAATGGCAGTATGAACATGAGTTTATCGCTTTGGTTC
TCCCAGGGATAGAGGAAAAGAATAGGGGCAACTCTGATGAAAGTTACCCTCTATCCCCGGCAGAACCCCGCCAGGTGCTCGGGTTGCTCTCCAGCATTGC
CCTATCCTCCTGGCGAGTAAGAGCCATCTATAGGGTAACCAGTTTTTCGGAGGAATTTCCATTTACACAAAATTATTTACACTCCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1218 bp405 aa601277+No
ORF function : Transposase
Description :

ORF sequence :

MQDLKDKTIRELAKGCRTVDDVHEMLKSLFKDTIQQILEAEMEEHLGYKKHSPEGNNTGNSRNGYSKKTIKTRFGETEISVPRDRNGEFEPRIVRKYETT
SNQLEEQIIAMYAKGMSTRDIEEHMRDIYGIDISPTMVSKITDKILPMISEWQSRPLERIYPVVFLDAIHFKVRKDGRIVNKAAYSVLGINMAGQKEVLG
IWVGEHESASFWLSVCNDLKNRGVQDILIACKDGLSGFSEAINTVFPKTEIQLCVIHQIRNSLKYVPYKEQKEFMADLKKVYQALTIEEAELAFTAFKEK
WGKRHPIIIRSWENNWLELTAYFKYPHEIRRLIYTTNVIEGYHRQLRKVTKTKTAYPTDEALVKLIYLATIEASKKWTMPIREWKKCMSQFAIYFEDRLE
SEMAV

 

Blast result :
Comments
ISDku1 is 74% aa similar to ISCbo4.
References
1] Romain Guérillot and Philippe Glaser (2013) Direct submission.
2] Lucas,S., Han,J., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S., Peters,L., Mikhailova,N., Lu,M., Saunders,E., Han,C., Tapia,R., Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Pagani,I., Nazina,T., Ivanova,A., Parshina,S., Kuever,J., Muyzer,G., Plugge,C., Stams,A. and Woyke,T. (2011) Direct GenBank submission.