ISPeth3

  • Family IS256
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_009454 ND Pelotomaculum thermopropionicum
Pelotomaculum thermopropionicum SI
DNA section
IS Length : 1584 bp

Ends


IR Length : 20/27

IRL : AGTTAAGTCCGTATAATTGTGTAAAATCGGTTTCCTGAAAAATGGTGGGA
IRR : GATCAAGTCCTAATTCTTGTGTAAAATTCCTCAGTCAGAAAAAGACTGAC

Insertion site


Left flankDirect repeatRight flankDR Length
GAAGATATATTCCTGAAACATGGCCGGT8
TTACCTCCATAACAGCAGGAATAAAATC8
GCTAGCTATTTCCTTGCGCGTATAGATT8
ATAGATCCGTGTTTTATAGATCCGCCCA8

DNA sequence

AGTTAAGTCCGTATAATTGTGTAAAATCGGTTTCCTGAAAAATGGTGGGAGCCATTTACAAATTCCTCAGTTAGAATAGAAGTTGGACAAACAAACATTC
TAAGAGGAGGAATTTGCATGGCTCAATATCAGATTACCGTAAATCAGGAACTTTTGCACCAACTATTTTTAAGTAATAACAAAGATTCCGGTATAGCAGC
CCTGCTGGAATCCGTATTGAACCAGATTTTACAGGCTCAAGCCACCGAGCAGCTTCAAGCCGGGCCATACGAACGCACCGATGAAAGAAAGGGATATCGC
AACGGCACATACCCGCACCAACTGACAACCCGGGTAGGAACCATAACCTTAAGAGTACCGCGTTTCCGCAACGGTCAGTTTTCCACCGAAATGTTCGCCC
GGTACCAGCGCAGCGAACAGGCCCTGGTGCTGACCCTGATGGAAATGGTAATCAACGGGGTCTCTACCCGAAAAATCAGCCAGATCACAGAAGAACTGTG
TGGCGCCGAATTTTCCAAGTCCACTGTCTCAGACTTATGCAAGAAACTGGACCCGCTGGTTATCTCTTGGAATAACCGGGACTTGCGGGAAATGCGCTAC
CCTTTTATATTGGTAGACGCTTTGGTGCTCAAAGTTCGTGAAGATGGGCGCGTCCGCTCCCGGGGTGTCATGATCGCCATCGGCCTAAACACCGAAGGAT
ACCGGGAAGTTTTAGGCATTATGCTTGGCGACAGTGAATCCGAAGCCAGTTGGAGCGAATTTTTCTCTTGGCTTAAAAACCGTAACCTGCGCGGTGTCGA
CCTGGTAGTGTCAGATGACCATAGCGGTTTGGTAAAGGCTGTTCGCAATCACTTCCAGGGAGTTACCTGGCAACGCTGCCAGACCCACTTTATGCGTAAT
ATCATGGACTCTGCGCCCAAATCTGTAAAGGAAGAACTTTACCCGCGCTTGAGGGCCATTTTGGATGCTCCGGATATCGGCAGCGCCCGGCTATTATTGA
ACCAAACCCTGGAGGCATTTGAGAAAAAGGCGCCTAGGGCCATGCGGGTACTTGAAATGGGCTTTGATGATGCTACGGCAGTGCTTGTACTACCGGAAAA
ATATCGCCTCCGGCTGCGCACTACAAACGGTGTTGAGCGCCTGATCGAAGAAGTCCGGCGCCGGGAACGTGTCATTCGCATTTTCCCGAACAGAGAATCG
GTAGTTCGTTTAATCGGAGCTTTACTCATGGAAATCGACGACAAGTGGGCAGCCGGTAAAAAGTATCTAGATATGGCCGAGTATCTTCAGTGGCAAAAGG
AACAAAAACATGACCGTCATCAAAACAATGTTGCTTATATCCGGTAAAATCTAAAATGGCAATATGGTTTTACTTTTGAACGTCGCTTGTTAATCAATCC
CAGCAATGTCAGTCGGCTGTCGCTGTCATATGTCTGCGTAGCGAAGACTAATCCTTTAACTTCGGCTTATGCCTGGCGGCGAAATGGATAATTTTAGCTG
CGGTGTTCAAATGAGTAATGTTATTCTTAACTATGTCAGTCTTTTTCTGACTGAGGAATTTTACACAAGAATTAGGACTTGATC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1230 bp409 aa1181347+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MAQYQITVNQELLHQLFLSNNKDSGIAALLESVLNQILQAQATEQLQAGPYERTDERKGYRNGTYPHQLTTRVGTITLRVPRFRNGQFSTEMFARYQRSE
QALVLTLMEMVINGVSTRKISQITEELCGAEFSKSTVSDLCKKLDPLVISWNNRDLREMRYPFILVDALVLKVREDGRVRSRGVMIAIGLNTEGYREVLG
IMLGDSESEASWSEFFSWLKNRNLRGVDLVVSDDHSGLVKAVRNHFQGVTWQRCQTHFMRNIMDSAPKSVKEELYPRLRAILDAPDIGSARLLLNQTLEA
FEKKAPRAMRVLEMGFDDATAVLVLPEKYRLRLRTTNGVERLIEEVRRRERVIRIFPNRESVVRLIGALLMEIDDKWAAGKKYLDMAEYLQWQKEQKHDR
HQNNVAYIR

 

Blast result :
Comments
ISPeth3 is 66% aa similar to ISCARN59.
References
1] Romain Guérillot and Philippe Glaser (2013) Direct submission.
2] Kosaka,T., Kato,S., Shimoyama,T., Ishii,S., Abe,T. and Watanabe,K. ( 2008) Genome Res. 18 (3), 442-448.
3] Kosaka,T., Uchiyama,T., Ishii,S., Enoki,M., Imachi,H., Kamagata,Y., Ohashi,A., Harada,H., Ikenaga,H. and Watanabe,K. (2006) J. Bacteriol. 188 (1), 202-210.