ISPebe1

  • Family IS256
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_AATQ01000004.1 ND Pelagibaca bermudensis
Pelagibaca bermudensis HTCC2601
DNA section
IS Length : 1363 bp

Ends


IR Length : 15/29

IRL : GGTGAGGTCCCAGGTCGTGGTGTAGCTTTCGGTGGCCATCGGGTTTCTCG
IRR : GATGATGTCCCGGGAAGTGGTGTAGCTCCTCATGGGCCTCGCGCTTTCGA

Insertion site


Left flankDirect repeatRight flankDR Length
CGCCGCTTTCGTTCAGGGCGTCCATGAT8
AGATGCCGTTGGTTGGGGGCATCCACCGC9
GCCAAACTCAGAGCGCAT/GTTTGCGGAAA10
GCAGGACTGATCGAAGGAGGATCGGGCA8

DNA sequence

GGTGAGGTCCCAGGTCGTGGTGTAGCTTTCGGTGGCCATCGGGTTTCTCGGTAGGGTCGGGTTGCTGACACCAACCTGAACCGAGGGATGCCCCCGATGA
CCAAACCCATGATGGACCTGCGTGCGCTGGTAGAGAAGAGCGCCGATGCCGACCTGCTTCGCGAGATGATCGGCTTTGCTGCCGAACGGCTGATGGAGTT
GGAGGTCGGCGCCAAGACCGGTGCTGACTATGGTGAGAAGACCAGCGAGCGCCTGGCGCAGCGCAACGGGTATCGCGATCGGGACTGGCAGACCCGGGCC
GGCAGCGTCGAACTGCGCATCCCGCGCCTGCGCACCGGCTCCTATTTCCCCTCGTTCCTCGAGCCGCGGCGCTCTGTTGAGAAGGCCCTGACGGCCGTGA
TCCAGGAGGCCTATGTCCACGGCGTCTCAACGCGATCGATGGACGACCTGGTGCAGGCCATGGGTGGCACCGGGGTGTCGAAGAGCCAGGTCAGCCGACT
GTGCGAGGAGATCGACGAGCGCGTGGATGCCTTTCTGACACGGCCGATCGAGGGCGAATGGCCCTACCTCTGGATCGATGCCACCTATCTCAAGGTGCGC
CAGGGCGGCCGGATCGTATCGGTTGCGGTCACGCTCGCGGTGGGCGTCAACACCGACGGCAGGCGCGAAGTGCTGGGCATGGCGATCGGGGCCTCCGAGG
CCGAACCCTTTTGGACCGAGTTCCTGCGTGATCTCGTCCGCCGTGGCCTCAGCGGCGTGAAGCTTGTGATCAGCGATGCGCATGAGGGCATCAAGGCCGC
CACCGCCCGGGTCCTGTCCACGACCTGGCAGCGCTGCCGCGTCCACTTCCAGCGCAATGCGCTCGCCCATGCCGGCAAGAACAGCCGCCGGGTGGTCTCG
GCATTCATCGCCACGGCCTTTGCCCAGCCCGACCACGCGGCGGCGAAGGCCCAGTGGCGTCTCGTGGCGGACCAGATGCGCGGCAAGCTCCCCAAGCTGG
CCACGCTCATGGACACGGCCGAGGAGGACGTCCTGGCCTATATGACCTTCCCGGCCCAGCATCGCACCAAGCTGCACAGCACCAATCCGATCGAGCGGCT
GAACGGCGAGATCAAGCGACGCACGGACGTCGTCGGCATCTTTCCGAACGAGGCTTCGATCCGGCGCCTCGTCGGCGCGATCCTCATGGAGCAGACCGAG
GAATGGACAGTCCAGCGCGCCAGATACATGACGCTGGAAACGCTCGCGCCCGTCTGCGATGATCTCGGTGTCAGTCTGCCTGCAGCGCAGAGCGACTGAC
CAGCTCGGCCCGCTCGAAAGCGCGAGGCCCATGAGGAGCTACACCACTTCCCGGGACATCATC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1203 bp400 aa971299+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MTKPMMDLRALVEKSADADLLREMIGFAAERLMELEVGAKTGADYGEKTSERLAQRNGYRDRDWQTRAGSVELRIPRLRTGSYFPSFLEPRRSVEKALTA
VIQEAYVHGVSTRSMDDLVQAMGGTGVSKSQVSRLCEEIDERVDAFLTRPIEGEWPYLWIDATYLKVRQGGRIVSVAVTLAVGVNTDGRREVLGMAIGAS
EAEPFWTEFLRDLVRRGLSGVKLVISDAHEGIKAATARVLSTTWQRCRVHFQRNALAHAGKNSRRVVSAFIATAFAQPDHAAAKAQWRLVADQMRGKLPK
LATLMDTAEEDVLAYMTFPAQHRTKLHSTNPIERLNGEIKRRTDVVGIFPNEASIRRLVGAILMEQTEEWTVQRARYMTLETLAPVCDDLGVSLPAAQSD

 

Blast result :
Comments
ISPebe1 is 85% aa similar to ISAli6.
References
1] Romain Guérillot and Philippe Glaser (2013) Direct submission.
2] Giovannoni,S.J., Ferriera,S., Johnson,J., Kravitz,S., Halpern,A., Remington,K., Beeson,K., Tran,B., Rogers,Y.-H., Friedman,R. and Venter,J.C. (2006) GenBank direct submission.