ISDgi1

  • Family IS256
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_AGJQ01000002.1 ND Desulfotomaculum gibsoniae
Desulfotomaculum gibsoniae DSM 7213
DNA section
IS Length : 1488 bp

Ends


IR Length : 23/28

IRL : GAGAACGTAATTAATTTAGTGTAAATGGTTATAACTACCAATAAAGGAGA
IRR : GGGAGTGTAAATAATTCCGTGTAAATGGCTTGATCCCGCTATAAACTGGT

Insertion site


Left flankDirect repeatRight flankDR Length
TTTCTGAAAATATATGAATGCCGCAACC8
CAAAGTAAATCTTTTGATATTGTAGAGT8
GGCAAAAACAGCGGAGTCCCGTGAAACT8

DNA sequence

GAGAACGTAATTAATTTAGTGTAAATGGTTATAACTACCAATAAAGGAGATGACCATTTATGCAAGCCATGCAAGACAAAACGATCAAGGAATTAGCAAA
GGATTGCCGCACCGTAGAAGACGTACATGAGATGCTCAAGAATCTATTCAAGGACACCTTGCAGCAGATATTCGAGGCTGAAATTGAAGAGCACCTCGGG
TATAAAAAACACAGCATTGAAGGCAATAATACTGGCAACAGTCGCAACGGTTACAATAAGAAGACTATCCAAACTAAGTTTGGCAAGACAGAAGTAGAAA
TCCCACGGGATCGTAATGGTGAATTTGAACCCAGGATTATCGGCAAATATGAAAAGACATCCAACCAGCTTGAAGACCAAATTATAGCCATGTACGCCAA
GGGTATGTCTACACGTGATATTGAGGACCACATGAGGGATATCTACGGTATCGACGTATCCCCTACCATGGTCAGCAAGATAACAGACAAAATACTACCG
ATGATTGCAGAGTGGCAGTCCCGGACACTTGACCGTATATACCCTATTGTTTTTCTTGATGCTATCCATTTCAAGGTTCGTAAAGATAACCGGATAATAA
ACAAGGCGGCCTATAGTGTGTTGGCCCTAAATATGGCTGGCCAAAAAGAAATACTTGGCATCTGGATTGGGGAAAATGAAAGTGCTAGCTTTTGGCTTGG
CGTATGTAATGATCTCAAAAGCAGGGGAGTGCAAGACATCCTGATTGCCTGTAAAGACGGGCTTTCCGGGTTTTCCGAGGCTATAAACACGGTTTTCCCC
AAAACCGAAATTCAGCTTTGTATCATTCACCAAATCCGTAATTCCCTAAAGTATGTGCCATACAAAGAACAAAAGGAACTGATGGCTGATCTTAAGCAAG
TATACCAGGCGTTAACCCTGGAAGAGGCCGAGTTAGCCTTTGAAATATTCAAAGAAAACTGGGGTAAAAGACATCCCATTATAATTCGTTCTTGGGAGAA
GAATTGGCTTGAATTAACAGCTTATTTTAAATACCCATATGAAATCCGTAAAATGATTTATACTACTAATATCATCGAGGGTTACCACCGGCAACTACGG
AAAGTAACCAAAACTAAAACTGCCTATCCAACAGACGATGCACTGAAAAAAATTATTTACCTGGCCACCGTTGAAGCAGCCAAAAAATGGACTATGCCAG
TTAAAGATTGGAAAAATTGCATCTCCCAATTTGCCATATACTTTGGTGATAGGATAGAATCAGAGATGGCTATATAAAAAAATTGAGTTTTACGCTTTTG
TTCTCCTCAAGGATAAATGTAAGGGATGAGGGGCAACAGGTTACCCCTCTGCTATCCCCGGCAGAACCCCGTTAGGCGCTCAGGTTGCTCTCCAGCAGAG
CCTTACCCTCCTAGCGGGAAAGAGCCATTACTAGCTTAACCAGTTTATAGCGGGATCAAGCCATTTACACGGAATTATTTACACTCCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1218 bp405 aa601277+No
ORF function : Transposase
Description :

ORF sequence :

MQAMQDKTIKELAKDCRTVEDVHEMLKNLFKDTLQQIFEAEIEEHLGYKKHSIEGNNTGNSRNGYNKKTIQTKFGKTEVEIPRDRNGEFEPRIIGKYEKT
SNQLEDQIIAMYAKGMSTRDIEDHMRDIYGIDVSPTMVSKITDKILPMIAEWQSRTLDRIYPIVFLDAIHFKVRKDNRIINKAAYSVLALNMAGQKEILG
IWIGENESASFWLGVCNDLKSRGVQDILIACKDGLSGFSEAINTVFPKTEIQLCIIHQIRNSLKYVPYKEQKELMADLKQVYQALTLEEAELAFEIFKEN
WGKRHPIIIRSWEKNWLELTAYFKYPYEIRKMIYTTNIIEGYHRQLRKVTKTKTAYPTDDALKKIIYLATVEAAKKWTMPVKDWKNCISQFAIYFGDRIE
SEMAI

 

Blast result :
Comments
ISDgi1 is 95% aa similar to ISPeth4.
References
1] Romain Guérillot and Philippe Glaser (2013) Direct submission.
2] Lucas,S., Han,J., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S., Peters,L., Land,M.L., Hauser,L., Parshina,S., Plugge,C., Muyzer,G., Kuever,J., Ivanova,A., Nazina,T., Klenk,H.-P., Brambilla,E., Spring,S., Stams,F. and Woyke,T.J. (2011) Direct submission GenBank.