ISRjo4

  • Family IS256
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_008269 ND Rhodococcus jostii
Rhodococcus jostii RHA1 plasmid pRHL1
DNA section
IS Length : 1458 bp

Ends


IR Length : 18/24

IRL : GAGGAATGCTCAGAACCTGTGGATCCCGGGAGGGCGTACCTTCCCGGAAG
IRR : GAGATATTGTCAATACCTGTGGATGAGGGAGTTTCAGGCAACCTCCGCTC

Insertion site


Left flankDirect repeatRight flankDR Length
CGTCGAGTCGACGGCAAATCGCGGATACT9
CTATATCTGGCCGCAGTGCGGATGAACTT9

DNA sequence

GAGGAATGCTCAGAACCTGTGGATCCCGGGAGGGCGTACCTTCCCGGAAGATGATCTACGAAGTTCACAGGAATCTGATCAAGACCAGCGCGCCAACGCT
GGCGGGAAGGTACGCCCGTGCTCACGGTAGTACACGACGACGACCGCTCCAACGACGACGTCGGGCGGTCGATGCTCGACGAGATCGTCCGCGATGGTGC
GCGGCAGATGCTGGCGGCCGCGCTGCAGGCGGAGGTGGCCGCCTATATCGAGCAGTTCGCTGATCAGGTCGACGAGAACGGTCGCCGCCTGGTGGTCCGC
AACGGCTACCATCACGAACGCGATGTGCTGACCGCCGCGGGCGCGGTCACCGTGAAGGTTCCCAGAGTGAACGATAAGCGCGTCGACCCGGACACCGGCG
AGCGACAGCGGTTTTCGTCCGCGATCCTGCCGGCCTGGGTACGTAAGTCCCCGCAGATGAACGAGGTGCTGCCGCTGCTGTACCTGCACGGGCTCTCCAC
CAGCGACTTCGGGCCGGCGCTCGAGCAGTTCCTCGGATCCGGTGCCGGACTGTCGGCGGCCTCGATCACCCGGTTGACATCCCAGTGGCAGGACGAGGCC
AAGGCCTTCCAGGATCGGGACCTCTCGGGCACCGACTTCGTCTATCTGTGGGTCGACGGCATCCACCTCAAGGTGAGGCTTGAGCAGGAAAAACTGTGCC
TGCTGGTGATGATCGGTGTCCGTGCGGACGGACGCAAGGAGCTCGTCGCCCTCACCGACGGGTACCGCGAGTCCACCGAGTCGTGGGCTGACCTGTTGCG
CAGCTGCCGACGCCGCGGCATGACCGCCCCAGTTCTGGCGGTCGGTGACGGCGCGCTGGGGTTCTGGCGGGCGTTGCGGGAGGTGTTCCCGGAAACCCGG
GAGCAGCGATGCTGGTTCCATAAGCAGGCCAACGTTCTTGCTGCGCTGCCGAAGTCGGCGCATCCGGGTGCGCTCGCGGCGATGAAGGAAATTTACAACG
CCGAGGACATCGACAAAGCGCAAGTGGCGATCAAGGCCTTCGAACTCGACTACGGCGCGAAGTATCCGAAGGCGGTGAAGAAGATCACCGACGACATGGA
TGTGCTGCTCGAGTTCTACAAGTATCCGGCTGAGCACTGGGTGCATCTACGCACGACAAATCCCATCGAATCCACTTTCGCCACAGTGCGACTCCGGACC
AAGGTCACCAAGGGTCCCGGGTCCCGTGCGGCGGGACTTGCCATGGCCTACAAGCTGATCGACGCCGCCCAGGCTCGCTGGCGGGCGGTCAACGCACCAC
ATCTGGTCGCGCTCGTTCGTGCCGGCGCGGTGTTCCACACGGGCAAGCTACTTGAGCGACCCACCGCCATCAGCCCCAACGCCGGGGCGGTCGAGCCCGC
AAGCACCGGAGCGGAGGTTGCCTGAAACTCCCTCATCCACAGGTATTGACAATATCTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1308 bp435 aa1181425+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLTVVHDDDRSNDDVGRSMLDEIVRDGARQMLAAALQAEVAAYIEQFADQVDENGRRLVVRNGYHHERDVLTAAGAVTVKVPRVNDKRVDPDTGERQRFS
SAILPAWVRKSPQMNEVLPLLYLHGLSTSDFGPALEQFLGSGAGLSAASITRLTSQWQDEAKAFQDRDLSGTDFVYLWVDGIHLKVRLEQEKLCLLVMIG
VRADGRKELVALTDGYRESTESWADLLRSCRRRGMTAPVLAVGDGALGFWRALREVFPETREQRCWFHKQANVLAALPKSAHPGALAAMKEIYNAEDIDK
AQVAIKAFELDYGAKYPKAVKKITDDMDVLLEFYKYPAEHWVHLRTTNPIESTFATVRLRTKVTKGPGSRAAGLAMAYKLIDAAQARWRAVNAPHLVALV
RAGAVFHTGKLLERPTAISPNAGAVEPASTGAEVA

 

Blast result :
Comments
ISRjo4 is 90% aa similar to IS666.
References
1] Romain Guérillot and Philippe Glaser (2013) Direct submission.
2] McLeod,M.P., Warren,R.L., Hsiao,W.W., Araki,N., Myhre,M., Fernandes,C., Miyazawa,D., Wong,W., Lillquist,A.L., Wang,D., Dosanjh,M., Hara,H., Petrescu,A., Morin,R.D., Yang,G., Stott,J.M., Schein,J.E., Shin,H., Smailus,D., Siddiqui,A.S., Marra,M.A., Jones,S.J., Holt,R., Brinkman,F.S., Miyauchi,K., Fukuda,M., Davies,J.E., Mohn,W.W. and Eltis,L.D. (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (42), 15582-15587.