ISRer3

  • Family IS256
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_012490 ND Rhodococcus erythropolis
Rhodococcus sp. IGTS8
Rhodococcus erythropolis PR4
Microbacterium sp. AJ115
DNA section
IS Length : 1471 bp

Ends


IR Length : 19/25

IRL : GAGCAATGATCAGAACCTGTGGATGGTTCTCGGCGAGGCGGCGTGAGTGG
IRR : GAGATATTGTCAAGACCTGTGGATGAGGGTGTTTCAGGCGACCTCCGTTT

Insertion site


Left flankDirect repeatRight flankDR Length
ACTCGATGGCCCCGCATTCAACATTAACG9
ACGGTCGGTCGCACCACGGTATCCACACAT10
GGCCAAGTTGTGTGCAACAACTTGTGTGCACCCGTACGTA0

DNA sequence

GAGCAATGATCAGAACCTGTGGATGGTTCTCGGCGAGGCGGCGTGAGTGGGCGCACCTTCCCGGGAATGATCTGAAATTCCATCAGCTCTGATCAGGACC
GGCGTTGGCGCGCTGGTTCGGGAAGGTACGCCCATGCTCACGGTAGTTCAGGATCAGCAATCCTCCAACGACGACAGCGGTGTTGGTCGGTCGTTGCTTG
ACGAGATCGTTCGCGACGGTGCCCGGCAGATGCTCGCGGCGGCGTTGGCCGCCGAAGTCGCCGCATACATCGAGCAGTTCGCCGAGCATCTCGATGAGCA
CGGCCGGCGGCTGGTGGTCCGCAACGGCTATCACCACGAGCGTGACGTGCTCACCGCGGCGGGGGCGGTGACGGTGACCGCACCGCGGGTCAACGACCGC
CGTGTCGACGCCGAGACCGGTGAACGGCAACGGTTTTCCTCGGCGATCCTGCCGGCGTGGTCACGCAAGTCCCCGCAGATGACCGAGGTGTTGCCGCTGC
TGTACCTGCACGGGCTGTCCAGCGGCGACTTCGGTGCGGCGTTGGAGCAGTTCCTCGGCACTGGTGCCGGGCTGTCGGCCTCGACGATCACCCGGCTGAC
CGCGCAATGGCAGGACGAGGCGAAGGCCTTCGCCGACCGGGATCTCTCGGGCACCGATTTCGTGTACCTATGGGTCGACGGCATCCATCTCAATGTCCGC
CTGGAGCAGGAGAAGCTGTGCTTGCTCGTGATGATCGGCGTCCGCGCCGACGGCCGCAAGGAGCTCGTCGCGCTCACCGATGGGTTCCGGGAGTCCACAG
AGTCGTGGGCTGATCTGCTGCGCTCATGCCGACGCCGCGGGATGACCGCCCCGGTGCTGGCCGTCGGTGATGGGGCGCTGGGGTTCTGGAAGGCACTGCG
GGAGGTGTTTCCGGATACCCGTGAACAGCGCTGCTGGTTTCACAAGCAGGCCAATGTGCTTGCTGCGCTGCCCAAGTCGGCTCATCCAGGTGCGACCGCG
GCGATGCGGGAAATCTACAACGCCGAGGACATCGACAAGGCCCAGGTCGCGATCAAGGCCTTCGAGGTAGATTACGGCGCGAAGTACCCCAAGGCGGTCG
CCAAGATCGTCGACGACGCCGACGTGCTCCTGGAGTTCTACCGGTACCCGGCCGAGCACTGGATCCACTTGCGCACTACGAATCCGATCGAATCGACGTT
TGCGACCGTGCGGTTGCGAACCAAGGTCACCAAGGGCCCTGGGTCACGCGCAGCGGGGATTGCCATGGCCTACAAGCTGATCGACGCCGCACAAGCCCGC
TGGCGGGCGGTCAACGCCCCCCATCTGGTCGCGCTGGTCCGTGCCGGCGCGGTGTTCCACAAAGGCAAGCTGCTCGAACGACCCATCGACATCTCACCCG
CTGAGCCCGACGAATCAAGCGAAACGGAGGTCGCCTGAAACACCCTCATCCACAGGTCTTGACAATATCTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1305 bp434 aa1341438+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLTVVQDQQSSNDDSGVGRSLLDEIVRDGARQMLAAALAAEVAAYIEQFAEHLDEHGRRLVVRNGYHHERDVLTAAGAVTVTAPRVNDRRVDAETGERQR
FSSAILPAWSRKSPQMTEVLPLLYLHGLSSGDFGAALEQFLGTGAGLSASTITRLTAQWQDEAKAFADRDLSGTDFVYLWVDGIHLNVRLEQEKLCLLVM
IGVRADGRKELVALTDGFRESTESWADLLRSCRRRGMTAPVLAVGDGALGFWKALREVFPDTREQRCWFHKQANVLAALPKSAHPGATAAMREIYNAEDI
DKAQVAIKAFEVDYGAKYPKAVAKIVDDADVLLEFYRYPAEHWIHLRTTNPIESTFATVRLRTKVTKGPGSRAAGIAMAYKLIDAAQARWRAVNAPHLVA
LVRAGAVFHKGKLLERPIDISPAEPDESSETEVA

 

Blast result :
Comments
ISRer3 is 98% aa similar to IS1166.
References
1] Romain Guérillot and Philippe Glaser (2013) Direct submission.
2] Sekine,M., Tanikawa,S., Omata,S., Saito,M., Fujisawa,T., Tsukatani,N., Tajima,T., Sekigawa,T., Kosugi,H., Matsuo,Y., Nishiko,R., Imamura,K., Ito,M., Narita,H., Tago,S., Fujita,N. and Harayama,S. (2006) Environ. Microbiol. 8 (2), 334-346.