ISRle12

  • Family IS256
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
JH719381.1 ND Rhizobium leguminosarum
Rhizobium leguminosarum bv trifolii WSM597
DNA section
IS Length : 1297 bp

Ends


IR Length : 30

IRL : GGGACTGTCAGGAATTCTGTGCGTGAGGCCATGATGATGGAAAGGAGAGA
IRR : GGGACTGTCAGGAATTCTGTGCGTGAGGCCGGTTCGTCATTGATTGAAGA

Insertion site


Left flankDirect repeatRight flankDR Length
GGAGGAACGGTGTTTCACATCTCTCCCCG9

DNA sequence

GGGACTGTCAGGAATTCTGTGCGTGAGGCCATGATGATGGAAAGGAGAGAATCATCACATGGCTATCGACAAGGAACTTCTGGACCAGCTTTTGGCTGGG
CGCGATCCGTCTGAGGTGTTCAGCAAGGATGGCTTGCTCGACGATCTGAGGAAGGCGCTTTCGGAGCGCATTCTCCATGCCGAGTTGGACGAGCATCTCG
ATGACGAACAGGCGGAGGGCAATGCCAATCGCCGCAACGGTTCTTCGAAGAAGACGGTGCTGACAGGTACGTCAAAGATGACGCTGTCGATCCCGCGCGA
CCGGGCCGGGACCTTCGATCCGAAGCTGATTGCGAAATACCAGCGTCGCTTCCCGGACTTTGATCACAAGATCATCTCGATGTATGCGCGCGGCATGACG
GTGCGCGAGATCCAGGGTCATATCGAAGAAATCTATGGCATCGAGGTGTCGCCGGATCTGGTCTCCGCGGTCACCAATGCTGTTCTCGAGGAAGTTGGGG
AATGGCAGAGCCGGCCGCTCGAGCTTTGCTATCCGCTCGTGTTCTTCGATGCAATCCGGGTCAAGATCAGGGATGAGGGCTTCGTCCGCAACAAGGCCGT
CTATATCGCGCTTGCCGTTCTGGCGGACGGCACCAAGGAAATCCTCGGCCTGTGGATCGAGCAGACGGAAGGCGCGAAGTTCTGGCTGCGGGTGATGAAC
GAGCTGAAGAACCGGGGCTGCCAGGATATCCTGATTGCCGTCGTCGACGGGCTGAAAGGCTTTCCAGAGGCGATCACTGCTGCTTTCCCGCAGACGATCG
TCCAGACCTGCATCGTGCATCTCATCCGCCATTCGCTCGAATTCGTGTCCTGGAAAGATCGAAAGCCGGTCGTCCCGGCGCTACGGGCAATCTACCGCGC
CAAGGACGCAGAGGCCGGAATGAAGGCGCTGGAGGCGTTCGAAACCGGATACTGGGGTCAAAAATATCCTGCCATCGCTCAGAGCTGGCGGCGCAATTGG
GAACACGTCATTCCCTTCTTCGCCTTTCCCGAAGGCGTGCGTCGAATCATCTACACGACCAACGCCATCGAAGCGCTGAACTCTAAACTCCGGCGGGCCG
TCCGCTCGCGTGGCCATTTCCCCAGTGACGATGCCGCCATGAAGCTGTTATACTTAGTTTTGAACCATGCGGCCGAAGACTGGAAACGTCCGCCCCGCGA
ATGGTTCGAGGCCAAAACCCAATTCGCCGTCGTCTTCGGCGAACGGTTCTTCAATCAATGACGAACCGGCCTCACGCACAGAATTCCTGACAGTCCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1203 bp400 aa591261+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MAIDKELLDQLLAGRDPSEVFSKDGLLDDLRKALSERILHAELDEHLDDEQAEGNANRRNGSSKKTVLTGTSKMTLSIPRDRAGTFDPKLIAKYQRRFPD
FDHKIISMYARGMTVREIQGHIEEIYGIEVSPDLVSAVTNAVLEEVGEWQSRPLELCYPLVFFDAIRVKIRDEGFVRNKAVYIALAVLADGTKEILGLWI
EQTEGAKFWLRVMNELKNRGCQDILIAVVDGLKGFPEAITAAFPQTIVQTCIVHLIRHSLEFVSWKDRKPVVPALRAIYRAKDAEAGMKALEAFETGYWG
QKYPAIAQSWRRNWEHVIPFFAFPEGVRRIIYTTNAIEALNSKLRRAVRSRGHFPSDDAAMKLLYLVLNHAAEDWKRPPREWFEAKTQFAVVFGERFFNQ

 

Blast result :
Comments
ISRle12 is 96% aa similar to ISNGR8.
References
1] Romain Guérillot and Philippe Glaser (2013) Direct submission.
2] Lucas,S., Han,J., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S., Peters,L., Ovchinnikova,G., Held,B., Detter,J.C., Han,C., Tapia,R., Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Pagani,I., Brau,L., Yates,R., O'Hara,G., Rui,T., Howieson,J., Reeve,W. and Woyke,T. (2012) Direct submission GenBank.