ISH31

  • Family ISH6
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_AGIR01000001.1 ND Halobacterium sp.
Halobacterium sp. DL1
DNA section
IS Length : 1445 bp

Ends


IR Length : 23/27

IRL : GGTCGTGTCGCAAAGTCCTCTAGAGTTCAGTAGTAACTGGCTCCCGTGAG
IRR : GGTCGTGTCGCAAAGCGGTCTAGACTTTGCCGCTGGTACTCTCAATTGAG

Insertion site


Left flankDirect repeatRight flankDR Length
CCCGTTCGGCAAAAACTTGGGGAAAAAG8

DNA sequence

GGTCGTGTCGCAAAGTCCTCTAGAGTTCAGTAGTAACTGGCTCCCGTGAGGAACGGGTCGCCTCTGGTATCCACCCAAGAGGTGACCCATGCACGCCACA
ATCGACGTGCGGTTTGAACTGAGTATCGACGACAACAAAACGCTACCGCTCGCCACGCTTGCCGAGGCCGTCACTGACCAGAACCTCGAAGCAGTACTCC
TTGAATCGCTGGTCGAGAGCCTCGACGCCGCCAGCGTCGAGGCGCTCTGTGGCGACAAACACGCCCACGGCAACGGTGACCAACGCTTCCAACGCGCCGG
CACCGATACCCGCACAGCTGTCACAACCGCCGGGGAACACGAGTTCTCTCTCCACTACATCGAAGATACAGCCGCTGATAACGACGAATCCAGCTATTTC
CGCCCCGTCGAAGACGTTCTTAGCTTCGACGGACAGAACCGCTATCAGCAGGACATCGCCGCCAAAAGCGTCGATCTCGCTACCTCGCTCAGCTATCGTG
ACGCTGCCGATCACGGCGACGGCTTCGTCTCGATGCCGTCGCCGACCACCATCAACCGCCGTGCCAAGAAATACGGCCACAAGCTCAAGCAGTTCCTCCC
AGACTGTGTCGCTGACACAGACGCTGACACCGTCATTCCTGACGGGACAAAATGCCACAGCCAAGACGACGACCGCTCGTCCCACTCCGTCCAAGCAACG
CTCGGCGAAGACACCGCCGAAGAGTCACGCTCCCTCCTGGATCTGTCGGTCAACGCTGACTGGGACGAAACTGCCGCCGAACTCGATGATATCGGCGCAG
TCACTGACGACGCGACGGTCGTCAGTGACGCTGATAGCGGCATCGTCACGGCCTTTACCGACGAAGCCCGTGACCACCAACTCGATCTCGTTCACGTCGG
CCGAACGCTGGGCTACACCCTCTGGGACGATGGCGTCTTCTCCTTGGACCGCCGGAAGGAGATCGTTTCGGAGGTGATCGACGAGGTATCCCATCTGAAG
AACTCGGTGGTGAAACACCATCCAGAAGAGGAGTTCGAGGCGATCCGCTCGCGGATCGCGCGAACGAGAGAGCGATTGGAGAAGACAGCGTGGCAACTGG
AGCAGTTCGGGTCAGCGAAGGCTGCAGGGTATCTTCGGCGGTGGCTGCCGTCGATTGTGACGTTCGCCGAGCACGCTGTCGAGGGGTTCGAGGTTCCGTG
GACCTCGAACCCCGTCGAACGACTGATGGGCGAGGTCAGCAAGCGGTGCAAGAACCAGTGGATGCGCTGGACAGCAGAGGGATTGGAAGCGATACTCCAA
CTTCGGTTGGTGAAGTACACCGACCCCGAGTACTACCAAGCGTTCCTCGACGAACTGCTCCAGCGTTCGACCAAAACAGCAATCAACTGTGACCTCTCAA
TTGAGAGTACCAGCGGCAAAGTCTAGACCGCTTTGCGACACGACC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1338 bp445 aa891426+No
ORF function : Transposase
Description :

ORF sequence :

MHATIDVRFELSIDDNKTLPLATLAEAVTDQNLEAVLLESLVESLDAASVEALCGDKHAHGNGDQRFQRAGTDTRTAVTTAGEHEFSLHYIEDTAADNDE
SSYFRPVEDVLSFDGQNRYQQDIAAKSVDLATSLSYRDAADHGDGFVSMPSPTTINRRAKKYGHKLKQFLPDCVADTDADTVIPDGTKCHSQDDDRSSHS
VQATLGEDTAEESRSLLDLSVNADWDETAAELDDIGAVTDDATVVSDADSGIVTAFTDEARDHQLDLVHVGRTLGYTLWDDGVFSLDRRKEIVSEVIDEV
SHLKNSVVKHHPEEEFEAIRSRIARTRERLEKTAWQLEQFGSAKAAGYLRRWLPSIVTFAEHAVEGFEVPWTSNPVERLMGEVSKRCKNQWMRWTAEGLE
AILQLRLVKYTDPEYYQAFLDELLQRSTKTAINCDLSIESTSGKV

 

Blast result :
Comments
ISH31 is 93% aa similar to ISH6.
References
1] Guérillot R, Glaser P, (2013) Diversity of bacterial prokaryotic mutator like transposase, association with conjugation conjugative elements and insertion specificity (on preparation).
2] Lucas,S., Han,J., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S., Peters,L., Land,M.L., Hauser,L., Dyall-Smith,M., Cavicchioli,R. and Woyke,T.J. (2011) Direct submission GenBank.