ISLde1

  • Family ISLre2
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP000412 ND Lactobacillus delbrueckii
Lactobacillus helveticus DPC 4571
Lactobacillus helveticus R0052
Lactobacillus helveticus H10
Lactobacillus delbrueckii subsp. bulgaricus CNCM I-1519
DNA section
IS Length : 1599 bp

Ends


IR Length : 21/29

IRL : CTAAGTGTATAATTTTTTTGCGGTAAGCTGAATAAAGGATTAAAAAAGCT
IRR : GTAAGTGTCAATGTTTTTGTGGTAACCTAAAAACCATTAGTCTGACCTTA

Insertion site


Left flankDirect repeatRight flankDR Length
AAAAGACAGATTTTGTATCT0
CTAGAATGTGCATGAATGACATGCATTTT9

DNA sequence

CTAAGTGTATAATTTTTTTGCGGTAAGCTGAATAAAGGATTAAAAAAGCTCAAGTCCGTTGAATTTGGACTTGAGCTAAAACAAAAAGACCAGTAGTCTG
ATGTTAACCCAAAAAACACATTAGAAGCTGGTCTTTTATGGAATCTATTATAACTGATATCGTGAAAATTATTAAGTCTGAAAATAATGTTCTTGCCCGT
GAAAAGGCATTAATGTGCTATTTCTTTGATCTGATTGGAGAGTTGATGAAGCTGGCACTAGAGGAAGTTGATGTTGGTTTAGTTGATGAAACTAAAAAGC
AAGGCTATCAGATTGAAAAGAAAAATAAGCGTTCAGTGGTGACAGTTTTTGGCGAAATCAGTTACTGGCGCAGAAGATATGCTTGTCCAGGCAAGAAGGC
CCGATACCCACTGGATAAGCTGATGGGCTATGACAAATACAAGCGTTACAGTGTTTTGACAGTAAAAGATGTTTTGCAATTTAGTGCTGTGGCAACTTAC
CGCAATACTGCCTTAGCTGTTAATACCCTGTCTAACTTTAACATTAGTCATAGTCAAGTTGGTAAGCTGATTGTTCAAGCGGGCAAGCAAATCAAGGCAC
AGCAACAGTCTGAAGAAAGGTACGATGGCATTACCCAAAAGAAAAAAGTACCAGTGCTTTATCTTGAAGGCGATGGCGTTGTAATTAAAGGGACCAAAAA
GCGGCTGGAGTTTCACCGCTATCAAGTCTGTGAAGATATTATTAATGTGAGCAAGACGCGCAGAAAGAGAGTTCAAGCCAAAGAGTTCGTTTCTTTAAGC
CGCTTGAATGCCTTGCAAGAAATCAAAGCTTATTTAGCTAATACCTATGACTTAAGCGATACTTTGATCATCAGTAATGCCGATGGCGGCGCTGGCTATG
CCAAAAAAGATTTTGATGAAATAGTCGGTCGCTGCAAGCAGCACGAACACTTCTTGGATGTCTTTCATTTGAATAAAAAGATTAAAGATCGTCTGGGCTT
TATGCCGGCTATGCAAGGCAAATTAATTAGTGCAGTTGAGTTTAAGTACGACCGTCGCTTGACTGATGTGATTTTAGATACAATTGAAAGCAATCTGATT
GACGAACTGTATACGCCAAAAAATCATGAAAACCTAAGGCGTCTGCGCGGCTATCTTCATCGGCACTGGGCTGATATTGAGCCGTTTAAGATGCGCAATT
TGCCAGTAATTAAAGCAATAGGCTGCTGCGAAAGCAATCACCGCAAGTATACCTATCGGGTTAAAGGACAAGGAAAATACTGGTCAGAGGATGGCGCCGA
AGGGATTCTGCGTGTGCTGACTTGCATCAAAAACAATGAACTGGAATATTGGCTAAGCAGCGAGTTTGCAGGCTCGGAAATAAATGCAATAACTGAGCAA
GAATTAAAAGCGGCAGCCCGTGATAGCCTAAAGAAGCGACATGAAAGTCATTTAGGCATACAGCGCGGAGCTTTAACAACGCAAACGGCTGGAAGCAGCT
ATTTAAGCAAATTCAATCGGATGCTAAACCACATAAATTATTAAGAAATTAAGGTCAGACTAATGGTTTTTAGGTTACCACAAAAACATTGACACTTAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1407 bp468 aa1381544+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MESIITDIVKIIKSENNVLAREKALMCYFFDLIGELMKLALEEVDVGLVDETKKQGYQIEKKNKRSVVTVFGEISYWRRRYACPGKKARYPLDKLMGYDK
YKRYSVLTVKDVLQFSAVATYRNTALAVNTLSNFNISHSQVGKLIVQAGKQIKAQQQSEERYDGITQKKKVPVLYLEGDGVVIKGTKKRLEFHRYQVCED
IINVSKTRRKRVQAKEFVSLSRLNALQEIKAYLANTYDLSDTLIISNADGGAGYAKKDFDEIVGRCKQHEHFLDVFHLNKKIKDRLGFMPAMQGKLISAV
EFKYDRRLTDVILDTIESNLIDELYTPKNHENLRRLRGYLHRHWADIEPFKMRNLPVIKAIGCCESNHRKYTYRVKGQGKYWSEDGAEGILRVLTCIKNN
ELEYWLSSEFAGSEINAITEQELKAAARDSLKKRHESHLGIQRGALTTQTAGSSYLSKFNRMLNHINY

 

Blast result :
Comments
ISLde1 is 91% aa similar to ISLhe10.
ISs of ISLre2 family preferentially insert in intergenic region, 15 to 17 bp upstream the -35 box of sigmaA promoters. [2][3][4]
References
[1] Romain Guérillot and Philippe Glaser (2013) Direct submission. [
[2] Brochet M, Da Cunha V, Couvé E, Rusniok C, Trieu-Cuot P, and Glaser P, P.(2009) Mol Microbiol. 71(4):948-59; [
[3] Guérillot R, Da Cunha V, Sauvage E, Bouchier C, Glaser P, (2013) Modular evolution of TnGBSs, a new family of ICEs associating IS transposition, plasmid replication and conjugation for their spreading (submitted) [
[4] Guérillot R, Glaser P, (2013) Diversity of bacterial prokaryotic mutator like transposase, association with conjugation conjugative elements and insertion specificity (on preparation).