ISPa47

  • Family IS630
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
Y Pseudomonas aeruginosa
Pseudomonas aeruginosa Ps159
DNA section
IS Length : 1107 bp

Ends


IR Length : 16/19

IRL : TTAACCTGGCAAATAAATAGGGCATATTAGATAATCTGTCTCCATGAAAA
IRR : TTAACCCGGCAATCAAATACACCAAATCATGCTGCGTAGGCGATACGTGG

Insertion site


Left flankDirect repeatRight flankDR Length
GCTCCGCAACTACTATTTCAAC2

DNA sequence

TTAACCTGGCAAATAAATAGGGCATATTAGATAATCTGTCTCCATGAAAATAGATGCCCGTAAACTCAGCCCCCAAGAACAACGTGAAAAGCGCTCCACG
GCCCTACGCATGCGTGAGCAGGGTTACACCTATAAGGCTATTGGCGAAGCGGTTGGTGTTCACCCCCGCACTATTGCTCACTGGGCGCAGGTCGCAGAAC
ATAAAGGCGAAAAGGCTGCCATTGCCGGCGGCCAGCGTGGTGTGCGCCAGGGTGATCGCCGCAGTTTGAGCTCCAGCCAGGAAGTGCTGATTCGCACCTT
GATGACCGATAAGATGCCCGACCAACTCAAGCTCGGCTTTGCGCTCTGGACGCGTGATGCGGTGCGAGAACTGATCCGCCAGCGCTGTGGTTTTCTCATG
CCGGTTCGAACGGTTGGTGAATACCTCAAGCGTTGGGGCTACACCCCGCAGCGCCCACTGCATCGGGCTTATCAGCAGAAACCTGAAGTGGTTCAGCACT
GGCTGGATAATGAATATCCACGCATCGCACAGCGGGCCAGGGCTGAGAATGGTGAGATTCAGTGGGGCGACGAAACCGGTATGCGCAGTGACAGCCATGC
TGGCCGCAGCTACGCCCCTATTGGCGAAACGCCGGTGCGCCTGGTCAGCGGCAGTCGTTTTTCCACCAACATGATTTCCACCGTGACCAATCGGGGCAAA
CTGCGCTTCATGCTGTATCGGGAAACGCTGACAGCCCCAGTGCTGATTCGCTTCCTGAGTCGCCTGATTCGCGATGCTCAGGGCCGCAAGGTGTTTCTGA
TTCTCGACAACCTGCGCGTACACCACAGCAAAAAGGTGAGCGCCTGGGTTGGCGACCGCAAAGAGCAAATCGAACTGTTCTTCTTGCCGGCCTACGCCCC
GGAGTTGAACCCTGACGAGTATTTGAATTGTGATTTGAAACATCAGGTTCGCACGGGCTTGCCGGCGCGTAATCAGGACGAACTGGAAAGGCGTGTTCGC
TCGGTCATGAGACGATTGCAATTACGCCCTCAAAGAATCCGTTCTTATTTCCGGCATCCACGTATCGCCTACGCAGCATGATTTGGTGTATTTGATTGCC
GGGTTAA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1038 bp345 aa441081+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKIDARKLSPQEQREKRSTALRMREQGYTYKAIGEAVGVHPRTIAHWAQVAEHKGEKAAIAGGQRGVRQGDRRSLSSSQEVLIRTLMTDKMPDQLKLGFA
LWTRDAVRELIRQRCGFLMPVRTVGEYLKRWGYTPQRPLHRAYQQKPEVVQHWLDNEYPRIAQRARAENGEIQWGDETGMRSDSHAGRSYAPIGETPVRL
VSGSRFSTNMISTVTNRGKLRFMLYRETLTAPVLIRFLSRLIRDAQGRKVFLILDNLRVHHSKKVSAWVGDRKEQIELFFLPAYAPELNPDEYLNCDLKH
QVRTGLPARNQDELERRVRSVMRRLQLRPQRIRSYFRHPRIAYAA

 

Blast result :
Comments
ISPa47 is 66% aa similar to ISCARN44.
This insertion sequence has been found truncating the oprD gene of Pseudomonas aeruginosa Ps159 strain. This inactivation of the oprD gene could be the cause of the carbapenem resistance phenotype in this strain.
References
1] Yolanda Sáenz Domínguez (2012) Direct submission.