ISRssp6

  • Family ISKra4
  • Group ISAzba1
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_AAMV01000007 ND Roseovarius sp.
Roseovarius sp. 217
DNA section
IS Length : 1454 bp

Ends


IR Length : 23/27

IRL : GGGAGTGGAAAAGTTCTGGGGTTTCAGATCGAGGGCGACCTAGTCTCCTG
IRR : GGGAGTGGAAAGGATCTGGGGTTCAAGCGGCGTTGAGGTGTCGGGTTGAC

Insertion site


Left flankDirect repeatRight flankDR Length
GAAAGGAAACGTGAATGAGA0

DNA sequence

GGGAGTGGAAAAGTTCTGGGGTTTCAGATCGAGGGCGACCTAGTCTCCTGCTGTCACGACAGGAGGGTTGACGATGAAAGTACGAATTAGGATCGAAACG
GAATTTGGCTGGGGCGAGCGTCGGGTTCATGATGTCGGTGTTCTGGAACGGCGTTCGACAGAGGCATGCGCGGAGGATTTCGGGCTAAGCCTTGCCGAAG
GGAAGGCAATCCTGAAAGAGATCCAAAGGGCAGTTCTGCAAGATCAAGTAGAGGAAATCAGTGAGATTGAGCGGGTTTGCCAGACCTGCCAAACCTACTT
GCCCATACATGATCGCCGGTCACGTCGGATAGACACTCTGTTCGGCCGTGTAACCGTCGAGGCACCACGGATCCGCATCTGCATGTGCCGTTTCCCGGGT
TTTCCAAACTGCACAGCAGCCTTCTCGCCACTCACGCGCATGCTCCCCGGAAATGCGACACCTGAACTTTGCAAGCTGCAGGCCGATTTGGCCGCGCGAC
ACAGTTTTCGTGAGGCCGCGCGGATTCTAAATGCGATGACACCATGCGCCAGACAAAACCACACGACAATTCGCAACCGTCTTGCCTCTGTCGCGGATGG
CTTGGAAACCCAGTGTGCCGAAATTCAAAAAGCCTTGGAAGTTCAACCTGATAGATCCGAGATGACAGTATTTCTGGATAGCGCCTATGTCCGCTCAAGA
CCCGAATATCAACGGCGGAACTTTGAAGTCATTGTCGGATCGATCGAGACCAAAACAGGCAACAAACGCCGTTTCGGATTGAGTCTTGCAGGGGCTGACC
ATCCCTTGGAGTGCCTGAAGTCCAATCTCAAAGCCGCAGGCTGGATCCCTGGTTCAGCCATAACAGTGTTGTCCGACGGTGATCCCGCCCTTCCGCGTCT
TGTGCGAAACGCAATCAATGGAAACGCCGAACACATCCTCGATTGGTGGCATATATCCGCCCGCATCAGGCACGTAGAGACAACGTTCCAAACCCTGCTG
TCGCAGCTTGAAAACAGCGAGACCTCCGATGTCGAGGCGCTTGTGGAACGGCTACGATGGCGCATCTGGCATGGCCAGGCTCACCGTGCGCTGGAAGCAC
TCGGAATCCTGTTCCGGTTTGCCATGCAGGCGCGCGATTGCGCTGCAGGTGACACAAAGGAAGCGGCAATGTCGGCAGCTGGTCGAACGATGGACCTCCA
GACCTACCTGACCCATAACCTGTCCGCTCTCGTCAACTACGGGCACCGGCGGAGGCAAGGAAAAGCTGTCTCGACATCGCGGGCCGAAGGCCTGGTCAAC
GAAATCGCCAATGTCCGAATGGGAAAGAAGCAGCGGATGCGGTGGTCACCAAGGGGCGCCCACATAGTCGCTACGGTTAGAGCGGCCGTTCTGGACGGAA
GACTGTCAACCCGACACCTCAACGCCGCTTGAACCCCAGATCCTTTCCACTCCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1359 bp452 aa741432+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKVRIRIETEFGWGERRVHDVGVLERRSTEACAEDFGLSLAEGKAILKEIQRAVLQDQVEEISEIERVCQTCQTYLPIHDRRSRRIDTLFGRVTVEAPRI
RICMCRFPGFPNCTAAFSPLTRMLPGNATPELCKLQADLAARHSFREAARILNAMTPCARQNHTTIRNRLASVADGLETQCAEIQKALEVQPDRSEMTVF
LDSAYVRSRPEYQRRNFEVIVGSIETKTGNKRRFGLSLAGADHPLECLKSNLKAAGWIPGSAITVLSDGDPALPRLVRNAINGNAEHILDWWHISARIRH
VETTFQTLLSQLENSETSDVEALVERLRWRIWHGQAHRALEALGILFRFAMQARDCAAGDTKEAAMSAAGRTMDLQTYLTHNLSALVNYGHRRRQGKAVS
TSRAEGLVNEIANVRMGKKQRMRWSPRGAHIVATVRAAVLDGRLSTRHLNAA

 

Blast result :
Comments
ISRssp6 is 50% aa similar to ISAzba1.
References
1] Murrell,J.C., Schafer,H., Ferriera,S., Johnson,J., Kravitz,S., Halpern,A., Remington,K., Beeson,K., Tran,B., Rogers,Y.-H., Friedman,R. and Venter,J.C. (2006) Direct submission GenBank.
2] ISfinder annotation (2008).
3] Guérillot R, Glaser P, (2013) Diversity of bacterial prokaryotic mutator like transposase, association with conjugation conjugative elements and insertion specificity (on preparation).