ISDpr10

  • Family ISKra4
  • Group ISKra4
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_ADZZ01000790.1 ND Delta proteobacterium
Delta proteobacterium NaphS2
DNA section
IS Length : 1682 bp

Ends


IR Length : 15

IRL : GAGTGTAACCTTTTTCGCTGAGCTGAACTTATTCTCTATAACCTATTGAA
IRR : GAGTGTAACCTTTTTTCGTCGGGATTCTATGCCGCTTTATTCTTGGAAAA

Insertion site


Left flankDirect repeatRight flankDR Length
AAAATCAATCAATTCATTCT0

DNA sequence

GAGTGTAACCTTTTTCGCTGAGCTGAACTTATTCTCTATAACCTATTGAAATTGTTTAAAATCAAATAGCTGGACATTCTCTCATTCGCGAATTAGACTA
TTGGTGAAAAAGAGTAGCCAATATCTTGAGCGGAGGGGAAAATGCCAGCGTATTCAATGGAAGAAAGTCTACTTGAAGGTCATGTGGAAGTCAAAAAACT
TTTTGAATTTGTTGAGGATAATGCTGCGTCTATGGACGCATACACGATGGAGCAGAACATCTTTTTCAAAATTCTTGCAATTGGTCTGTCTGCCATGAAA
GGCTATTTTGCTCAGAAAGGTACCGGAGACGTAGGAGCTTCCTTGGATTTGGAGGACGGAACCGTATTGAAAAGGCAAAAGTCGCCTTCTGACAGGAATT
ACTTTTCGGTTTTTGGCAAACTTTCGGTTCCGCGCACCTGCTATCGAGCAGATGGTGTTAATGGGGTAATGCCATTGGATGCTCAGGCAAATCTTCCTGA
AAGAAGCTACTCGTACCTTCTCCAAGAATGGATGGATCTTTTGAGCATTCGAGATTCTTTCGGAGAATCCTCTTGCACCCTGCAAAAACTGCTGAACTTG
AAAATACATCCGAGCCGTTATGAAGTTGTAAATCAGGAATCATCAAATAGCTACGATGAATTTTATGAGAGTAAGGAGCCTCCGAGTCCGGAAAGCGAAG
GCAGCGTTCAGGTAATTGGTTTCGATGGAAAAGGCGTTCCTGTCATCAAGCAAGAGGCTGCCAAGATACAGGCCCGGCTTGGAAAAGGAGAAAAGCGCCA
GAAAACAAAAGAAGCCATTGTAGGGGTCAGTTATACAGTTGATCCCAAGGTACGAACACCTCGTGAAGTTGCCGAAAATCTCGTTTATCCGGAAAAAAGC
AAAGAAGAAACAGATACCCCGAATAAACAAGATGTTAAGGCATCTCCCATACGCGCATCAAATCCTCGTCGAATAGCCAGTTTGGAACGATCCAAGAAAG
ACGTCATGATGGAAATTTTAAAGGATGCTAAAGTCAGGAACCCCGATAACCGAAAATCTCTTGTAGCGGTCATGGATGGTGCACTGTGCCTATGGTCTCT
ATTGAGCACCGTGTTGGCTGGTGTGAAATGGGTGGGTATTTTGGACATTATACATGTCGTAGAATACCTTTGGAAAGTGGCCAATTCCTTGTATGGTGAA
AACACCCGCGAAGGGAAAAAATGGGTATATGACCATCTGATGGCAATTTTGCAGGGCCGTGTTGGAAGAGTTATTGGAGGCATGAAACAGATTTTGAACA
AAAGAAAAAAGTTAAAGAGCGGTCAGAAAAAAGCCTTGAGAGAAACCATCAAGTATTTTGAAAATCACCGCCAATGGATGCGCTATGATGAGTACCTGGC
CTCTGGATATCCGATAGGAAGCGGCGTCGTAGAGTCCACTTGCGGACACACCGTTAAAAAGCGAATGGAAGGAACAGGTCGCAGGTGGTCAATTAAAGGT
GCCGAATCCACGCTGCTTTTGCGGTCCGTCTATACCAGCAATGATTGGGATGCTTACTGGGAGAACCATCGTCAGCAGGAGCAAAAGCGGCAATACGGCA
AAATCCTACCGCTTTTGGCATGCTCCGACGATTTTTCCAAGAATAAAGCGGCATAGAATCCCGACGAAAAAAGGTTACACTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1515 bp504 aa1421656+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MPAYSMEESLLEGHVEVKKLFEFVEDNAASMDAYTMEQNIFFKILAIGLSAMKGYFAQKGTGDVGASLDLEDGTVLKRQKSPSDRNYFSVFGKLSVPRTC
YRADGVNGVMPLDAQANLPERSYSYLLQEWMDLLSIRDSFGESSCTLQKLLNLKIHPSRYEVVNQESSNSYDEFYESKEPPSPESEGSVQVIGFDGKGVP
VIKQEAAKIQARLGKGEKRQKTKEAIVGVSYTVDPKVRTPREVAENLVYPEKSKEETDTPNKQDVKASPIRASNPRRIASLERSKKDVMMEILKDAKVRN
PDNRKSLVAVMDGALCLWSLLSTVLAGVKWVGILDIIHVVEYLWKVANSLYGENTREGKKWVYDHLMAILQGRVGRVIGGMKQILNKRKKLKSGQKKALR
ETIKYFENHRQWMRYDEYLASGYPIGSGVVESTCGHTVKKRMEGTGRRWSIKGAESTLLLRSVYTSNDWDAYWENHRQQEQKRQYGKILPLLACSDDFSK
NKAA

 

Blast result :
Comments
ISDpr10 is 41% aa similar to ISSiac4.
References
1] Guérillot R, Glaser P, (2013) Diversity of bacterial prokaryotic mutator like transposase, association with conjugation conjugative elements and insertion specificity (on preparation).
2] DeBoy,R., Durkin,A.S., Methe,B. and Young,N. (2010) Direct submission GenBank.