ISEc51

  • Family ISKra4
  • Group ISAzba1
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_AEME01000001.1 ND Escherichia sp.
Escherichia sp. TW09308
DNA section
IS Length : 2857 bp

Ends


IR Length : 24/26

IRL : GAGGGCATGAAAAACCCTGGGGCAGTCACTGAATGAGGGACCAGCAGCGG
IRR : GAGAGCATGAAAAACCTTGGGGCAGTAGCTATGCTGCCATAGCGGATAAC

Insertion site


Left flankDirect repeatRight flankDR Length
TCTGCTTGCCACAGGAAGCTCGTTCAACTCAAT0

DNA sequence

GAGGGCATGAAAAACCCTGGGGCAGTCACTGAATGAGGGACCAGCAGCGGTAAAATAACCGGCATAATTTTATAATGATGCCTCCGTTAGTTATGAAGGT
TTACGTCATTAAAATTGCTGTTCGTGGTGTCAGTCCTATGGTCTGGCGTCGGCTGAGGATTGCAGCCGATACATCACTGGCTGCACTTCATTTTATTATC
CAGATCATTCAGGGCTGGGGTGATGACCACCTGCACCAGTTTCATATTTACGGTAAAGATTACGGTATCACTTACGAGGGGGGAATTGGTTTTCCAGATA
ACCCGTTCCAGGTTGTGATTGATGATTTTGAGTTTGATGTCGGCGATCGCTTTACTTATGAATACAATTTCTTTGAGCACTGGATTCATGATATTCGCGT
TGAAGCCATTTATGAAAACACCGAGCTGAAAACGCCATTTTGTATAAGTGGTCATGGTATGCCCGGAGCCACAGTTGCAGATGAGTTTGATAAAACCCTG
GCGTTTCTTGAAGCTATCGTTAATGCAGATGATGAAACAACGATTGGTGAGATTCGCCCTTTTGCTGACGACCTGGACGCTGTCCGGTTTAACCGCAACA
AAATCAACCGGCGGCTAAGCAAACTCAACCTTGCCTCTCCAGCGCTGGAGCCTGAGGTAATTTAGCTGGGGCGTCGTCGCTGACTGCTTCTATAAAGGTA
TACGTTTTCAATATGTCCTTCAGTTACCCGGAAAAATATCTATAAACCTCCATAAATCGGTGTTTATGAATTATTCTTTAAATCTCTATAATGTTTAAAG
ACATTCCGGAGGTTTCACATGCAATATGCCTACATCAGGGTGAGCTCAGCCGACCAGAATACAGCACGTCAGGAAGAGGCATTGTTAAAGGCGGGTTTTC
AGCCAGATAAAATTTATGTTGAACATGCCAGTGCTAAGGATACAAACCGACCGGAGTTGCAGAAGCTCCTTGAGCAACTGCGCCCGGGAGATACGCTTCT
TGTCCATTCCATCGATCGCCTTTGTCGGAATATGATGGATATGTGTGCTGTAACAACCAGGCTTCGGGAGATGGGCGTTACCCTTATTTTTCTGAAGGAA
CAGCTTACGTTCAATGCAGGAATAAGCAATCCAATGCAGGAGTTACAGTTGCACATGATGTCTGCATTCAGTCAGTTTGAACGTGCTTTACTGAAAGAAA
GGCAGGCTGACGGTATTGCAGCGAAAAAAGCGCGGGGAGAAAAAACAGGGCGTCCCTGCGCAGATATCAAAAAAGTTCAGGAAATTGATGAGCTCAGAAG
TCGTGGAGTCAGACTCAGGATCGCCTGCGACCATGCTGGTCTCGGCGTTTCAACATATTATAAGCTTCGCAACCAGATGAAAAACCAGTAACCAGGAGAT
AATCTCACCACCGCCGGAGGCAATAATGAAACTGATATTTCAGATAGTTATAACCGATGAATCAGGCTCCAGTCGAACGGAAGAACTGATGAACCTGCAG
AAATCAGGAGATGCCCTGAATGATATCGGATTATCAGTTTCAGAATCGAAGCAGTTGTTGGGGGCAGTCCAGAAGTCGCTGGTTCAGCAACAGGCTGACG
AATATATTCACCAGAATATCCGATGTCCTCACTGCCTTACGAAGCGCAGAATCAAAGGCCAACAAAAAATCCAATACCGGACGTTGTTTGGCGTTATTCC
TGTATCAGGGCTTCGGGTGTATCGGTGCCGCTGTGAAGAAAGTGCAACAAAAACAGTCAGTCTGCTCAGTGACTGGGCTGGAGATCACACTCACCCTGCA
CTGAAATATATAGAAACCCGCTGGGCCTCTTTGATCTCGTATGAAATGACGGTTCGTTTACTAAAAGATGTCCTGCCGGTAGGGTACAGTCTGAATGCCT
CAACAGTGAGGAATCATTTATGCCGTGTGGCACAGCGTCTTGATTCTGAGGCAGAATCACATTCCGGCTTTATTTCAGGTTGCCCCCGCGACTGGGGAAA
CCTGCCAAAACCGGGAAAACCTCTGGTGGTGGGTATTGATGGCGGTTATGTCCGCGATCGGGATAACAAGAAACGTAATTTTGAAATTATTGCCGGTAAA
TCATTTTCAATCGGAGCACCGGCCGACGCACGTCGCTTTGGTTTTGTCCAGAAGAGCGACTGTCATCCGGAACGTCGGCTCATGGCACACCTCTCTGCTC
AGGGAATGCAGGCTAACCAGCAGATATTCTTTTTATCCGACGGCGCGGATAATCTGAGAGAACTGCAGTTCGGTATGTACCCTGAGTCAATTCATGTGCT
TGACTGGTTTCATATAACGATGAGGCTGACGGTGTTAATGCAATATGCAAAGGGGTTGCAGGCATCAGAGCCAGCGACGGGCAGTAAGGTGTTATCGCTT
CTGGAAAGCAGTAAACGATATCTCTGGCACGGTAATGTTGCCACTGCACTGGATCGCATTGACGATTGCGTTATGTATTGTGATGACCCTGAACTCAACT
ATGTAAACCTGAAAGCCCTGCAAAAACAGCTGGATGAGATGTATACCTACATCCGTAATAATCAGATGATGATCCCAAACTACGGAGAAATGTGCCGGTA
TGGTGAGCCGGTTTCAACAGCGTTTGTCGAGTCAACAATCAACGAAGTGATCGCCCGACGAATGGCCAAAAAGCAGCAGATGCAGTGGAGTAGAAAGGGC
GCGCATTATTTGTTACAGACCAGAACTGCAGTCCTGAATAACGAACTACGGGACAAATTCGCCAGTTGGTATCCCGGTTGTACGATAGACGCTCAGAGTA
GAGGGACGTTATCCGCTATGGCAGCATAGCTACTGCCCCAAGGTTTTTCATGCTCTC
Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
591 bp196 aa75665+No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MMPPLVMKVYVIKIAVRGVSPMVWRRLRIAADTSLAALHFIIQIIQGWGDDHLHQFHIYGKDYGITYEGGIGFPDNPFQVVIDDFEFDVGDRFTYEYNFF
EHWIHDIRVEAIYENTELKTPFCISGHGMPGATVADEFDKTLAFLEAIVNADDETTIGEIRPFADDLDAVRFNRNKINRRLSKLNLASPALEPEVI

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
573 bp190 aa8191391+No
ORF function : Passenger Gene
Annotation : Serine recombinaseDescription :

ORF sequence :

MQYAYIRVSSADQNTARQEEALLKAGFQPDKIYVEHASAKDTNRPELQKLLEQLRPGDTLLVHSIDRLCRNMMDMCAVTTRLREMGVTLIFLKEQLTFNA
GISNPMQELQLHMMSAFSQFERALLKERQADGIAAKKARGEKTGRPCADIKKVQEIDELRSRG VRLRIACDHAGLGVSTYYKLRNQMKNQ

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1404 bp467 aa14262829+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKLIFQIVITDESGSSRTEELMNLQKSGDALNDIGLSVSESKQLLGAVQKSLVQQQADEYIHQNIRCPHCLTKRRIKGQQKIQYRTLFGVIPVSGLRVYR
CRCEESATKTVSLLSDWAGDHTHPALKYIETRWASLISYEMTVRLLKDVLPVGYSLNASTVRNHLCRVAQRLDSEAESHSGFISGCPRDWGNLPKPGKPL
VVGIDGGYVRDRDNKKRNFEIIAGKSFSIGAPADARRFGFVQKSDCHPERRLMAHLSAQGMQANQQIFFLSDGADNLRELQFGMYPESIHVLDWFHITMR
LTVLMQYAKGLQASEPATGSKVLSLLESSKRYLWHGNVATALDRIDDCVMYCDDPELNYVNLKALQKQLDEMYTYIRNNQMMIPNYGEMCRYGEPVSTAF
VESTINEVIARRMAKKQQMQWSRKGAHYLLQTRTAVLNNELRDKFASWYPGCTIDAQSRGTLSAMAA

 

Blast result :
Comments
The two first ORFs are passenger genes annotated as hypothetical protein (ORFA) and putative transposon resolvase (ORFB).
References
1] Guérillot R, Glaser P, (2013) Diversity of bacterial prokaryotic mutator like transposase, association with conjugation conjugative elements and insertion specificity (on preparation).
2] Luo,C., Walk,S.T., Gordon,D.M., Feldgarden,M., Tiedje,J.M. and Konstantinidis,K.T. (2011) PNAS.