ISDesp4

  • Family ISKra4
  • Group ISKra4
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
FR695879.1 ND Desulfobacterium sp.
Desulfobacterium sp. (Uncultured)
DNA section
IS Length : 1849 bp

Ends


IR Length : 21/25

IRL : GGGTCTGCGACATAAATATGGGTAAAAACTTGACAAGGCGAGATATTTCG
IRR : GGGTGTGCGACAAATTTATGGGTAACGATTTCAGATTGCGGCCCGATGTT

Insertion site


Left flankDirect repeatRight flankDR Length
CCCGAAATTTAAATCATAAA0
CAAATACCAGATTCGATAAC0
GATTCGATAAAAATCATAAA0
TTTTTGTGAAAAATACCAGA0
TACAGAAACAGCCTGAAGTT0

DNA sequence

GGGTCTGCGACATAAATATGGGTAAAAACTTGACAAGGCGAGATATTTCGCCTATAGTCTGATTGCTTGTTAAGCATTCAGACCATAGGAGGAAGCCGAT
GGAAGAAACTATTGAAAGCTTGGAGATAGAGCGGGAACATTTATATAGGCAATTGCAAGAAACCGGAGATTTCCGGAGGGGAATCATTTCAGTTGTATAC
CGTAAATGTGGGAAAAAAAACTGCGCATGCGCTAAAGAGGGGCATCCAGGGCATGGGCCGCAACATTTATGGAACACAACAATCAAAGGGAAAAGCTACG
CGAAGAGCGTAAAACTTGGTCCGGAGTTGCAAAAGTACCTGGAGGAGATTGCGAACCATCAACGCTATGTAAAGCTGTGTGAAGAGATTGTTTTGGTAAA
CGAGCGTATCTGCGACCTTCGACCAGTGCCCGAAGTGAAAGATGATCAGGAGTTGGCCGAACTTAAAAAAAAATTGCAGAGTCTGTTCATGAAGAAGTAC
AAAATGAGATAGGTCGCATTGTTGGCCGGTATGTTTCAGAAAAAACGACCAACGGCAATTTTGACTTTGAAGCGTTTGAAATGAGCATCCGTTCGTCAAT
GCACCGCATTGGCGGCAGCATACTTGGAATACTCGTAAACGCAGATGGCGGAGGTTACCGGGGTAAAACCATTACCTGCGGGCAAGGGCATCAGTATGAG
TTTATCGATTACCGGAACAAGGAACTGCTCACTGTGTTGGGCCCGGTGGCCGTTAAGCGGGCATACTATTATGATCGAAAATGTCATGTTGGTTTTTGCC
CGAAAGACCGTGATCTGGACATAGGGACATCTTACAGTTGTGGGGTACGCCGGATGATGAGCAAGGTTGGCGCCTACCGGCCATTCGGCCTGGGTCATCA
AGACTTGTATGAGCTGGCGGATATCCGTGTCAACACAAAAGCAGTAGAGCGTGTATCACAGACAGTAGGTGCTCAGGTGGAAGCGTTTCATGCAGCCGAG
GCCAGGACGTCGTTGTCGGATAAAATTGTACCGATCAAACCTGTTCCACGGATGTATGTGTGCATGGATGGCACCGGAGTTCCGGTAGTTAAGAAAGAGA
CTGCCGGCAGGCAAGGCAAATGTGAAGACGGTCAGGCAAAGACCAGGGAAGTCAAGCTGGGTTGCATTTTTACCCAGACAGAAGTTGACCGGAAAGGCCG
TCCGGTGCGAGACGATGGGACCACCAGCTACACCGGTGCAATCGAATCGGCTGAGGTGTTTGGACAGCGGATATATCAAGAGGCACTTCGGCGCGGCATG
CGCCGGGCAAAGGAGGTTTGTGTGCTTGGGGACGGGGCCATCTGGATATGGAATATAGCGGATGAACAATTTTATGGTGCTATCCAGATTGTCGATCTGT
TCCATGCGCGTGAACATTACTGGAACGTCGGTAAGGCATATTTCAGTCAGAATAAGGACAAACTGCATCTGTGGACGGAAGAGCGTCGGAAAGAATTGGA
TGATGGAAGGGTCGAAGATGTAATGAATGCCATCAAGGAATGCTCATCTCAATCGGGATGCGACAAATCAATATATGAACGAGAGATCGGTTATTTTGAA
AAAAACAAGGAAAGGATGCGGTACGCCCATTTTAGGAAGCGGGGTCTTTTTATAGGTTCCGGCGTTCTGGAGGCAGGCTGTCGAACCGTGGTTGGACAGC
GGCTGAAACAGTCGGGTATGCACTGGACGGTTAGTGGCGCAAATAGTATAATAGCTCTGCGCTGTAGTATTCTAAGCAACCGTTGGGAAGATTTTTGGGA
ACATCGGGCCGCAATCTGAAATCGTTACCCATAAATTTGTCGCACACCC
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
414 bp137 aa99512+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MEETIESLEIEREHLYRQLQETGDFRRGIISVVYRKCGKKNCACAKEGHPGHGPQHLWNTTIKGKSYAKSVKLGPELQKYLEEIANHQRYVKLCEEIVLV
NERICDLRPVPEVKDDQELAELKKKLQSLFMKKYKMR

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1353 bp449 aa4671819+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

KKIAESVHEEVQNEIGRIVGRYVSEKTTNGNFDFEAFEMSIRSSMHRIGGSILGILVNADGGGYRGKTITCGQGHQYEFIDYRNKELLTLGPVAVKRAYY
YDRKCHVGFCPKDRDLDIGTSYSCGVRRMMSKVGAYRPFGLGHQDLYELADIRVNTKAVERVSQTVGAQVEAFHAAEARTSLSDKIVPIKPVPRMYVCMD
GTGVPVVKKETAGRQGKCEDGQAKTREVKLGCIFTQTEVDRKGRPVRDDGTTSYTGAIESAEVFGQRIYQEALRRGMRRAKEVCVLGDGAIWIWNIADEQ
FYGAIQIVDLFHAREHYWNVGKAYFSQNKDKLHLWTEERRKELDDGRVEDVMNAIKECSSQSGCDKSIYEREIGYFEKNKERMRYAHFRKRGLFIGSGVL
EAGCRTVVGQRLKQSGMHWTVSGANSIIALRCSILSNRWEDFWEHRAAI

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1721 bp572 aa991819+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MEETIESLEIEREHLYRQLQETGDFRRGIISVVYRKCGKKNCACAKEGHPGHGPQHLWNTTIKGKSYAKSVKLGPELQKYLEEIANHQRYVKLCEEIVLV
NERICDLRPVPEVKDDQELAELKKKIAESVHEEVQNEIGRIVGRYVSEKTTNGNFDFEAFEMSIRSSMHRIGGSILGILVNADGGGYRGKTITCGQGHQY
EFIDYRNKELLTLGPVAVKRAYYYDRKCHVGFCPKDRDLDIGTSYSCGVRRMMSKVGAYRPFGLGHQDLYELADIRVNTKAVERVSQTVGAQVEAFHAAE
ARTSLSDKIVPIKPVPRMYVCMDGTGVPVVKKETAGRQGKCEDGQAKTREVKLGCIFTQTEVDRKGRPVRDDGTTSYTGAIESAEVFGQRIYQEALRRGM
RRAKEVCVLGDGAIWIWNIADEQFYGAIQIVDLFHAREHYWNVGKAYFSQNKDKLHLWTEERRKELDDGRVEDVMNAIKECSSQSGCDKSIYEREIGYFE
KNKERMRYAHFRKRGLFIGSGVLEAGCRTVVGQRLKQSGMHWTVSGANSIIALRCSILSNRWEDFWEHRAAI

 

Blast result :
Comments
ISDesp4 is 42% aa similar to ISDpr10.
The third ORF is the putative ORFAB transposase reconstructed in silico buy possible -1 frameshift.
References
1] Guérillot R, Glaser P, (2013) Diversity of bacterial prokaryotic mutator like transposase, association with conjugation conjugative elements and insertion specificity (on preparation).
2] Bergmann,F., Selesi,D., Weinmaier,T., Tischler,P., Rattei,T. and Meckenstock,R.U. (2011) Environ. Microbiol. 13 (5), 1125-1137 .