ISLfe1

  • Family ISKra4
  • Group ISKra4
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
GG693873.1 ND Leptospirillum ferrodiazotrophum
Leptospirillum ferrodiazotrophum
DNA section
IS Length : 1800 bp

Ends


IR Length : 23

IRL : GGGTGAGCGACAAATTTTAGGACGCGCCTCCCGTCAAGGATCTTGGGAAC
IRR : GGGTGAGCGACAAATTTTAGGACTTAGATATATCGTCTTAAGTCTTTGTT

Insertion site


Left flankDirect repeatRight flankDR Length
CAAGGGAGGCATCCTCAGGGGGCGCCCCA9

DNA sequence

GGGTGAGCGACAAATTTTAGGACGCGCCTCCCGTCAAGGATCTTGGGAACGACATGGCCCGCAGAACATTGACTGACAGACATGTTGATGGCCAGGCAAG
ACGCGCTGGACATTCCTGTATGATTTTGTTATGGATAGAAGGACGTTAGAAAAACTTCCCCCTTCTTCCATAGGAGCGTTCCATGAGCCCTCGAAAAAGA
CCCCCTGCGGACCCGACATCTCCCCCGGCCGATCAGGCCCAGGAAGCCCTTCGCACCATGGAGGCGGCCTTGCGTCAGAAGATTGGAGCGGCCCCGAAGG
GCTCCGACGAAAAGAGACATCTTCAGGAGCTTCTCTCTCTTCTTTCCGGACAAAAGACTCCCGAGGCTCCCCCCACGGCCTCAAAAGCCCCCACCCCCTC
GTTTGCCTCGATCCTCGAGGAGGTGAGCCAGCCGATGATCCGCTCCTCCCGACGATTGGACTTCGGAGCCATGGAGAGGGCCATGAAAGACCGGATGCTC
GAAGAGACGGCCCGAACCCTCGAGTCTCGCCTGAACGAGGAGATTACCCGCCACCCGGCCCCCTTCCGTTGTCCGGCCTGCGGGCGCCTCCTTCAGAGCA
AGGGGATGAAATCCAAGACCTTTATGACGTCGCTCGGAGAGATCACCCTCCGCCGGCGTTACGGGTTTTGTCGCTCCTGCCGGAAGGGGAGCTTCCCCGA
CGATGCCCGCCTGGGACTCGACGAGACAGGCGTCTCTCCCGAGGTTCAGTATCTGGCCGGCCTCTTTGGCGCCGAGACGGACTTTTTGAGAGCGAGCGAC
CTGCTTTTTTGCGCCGCTCGGATCCGGCTTCCGGAAAAGCAGGTCGAGCGGCTCGCCAAGTCCCTTGGGGAGCAGATCGCTCAAGACGAACGGGAGCATG
TCGAGCTCGAGCCTCACCGCCTCCCCCAGGGCCCCCTTTATATCGGGATGGATGGGACGGGTGTACCGATCCAGTCGCGCGAGACAGCCGGGAGACGCGG
CAAGCAGAAAGACGGCTCCTCCAAGACTCGCGAGGCCAAGATGATCGACATCTGGGAGGCCCATACGCAAAACGAGCGGGGAATCCCGATCCGGGACCCC
GGATCGGTCTCCTACTCGGCGGCCATCGAAAGTGCCTCCTGCCCGGACTTCGCGCAGATGCCCTCCGACTTTGCCCGGCGGGTCGAGCGCGAGGCCTCCC
GACGCGGGGCCGCACAGGCCCGTCAGATTGTCGTCATCGGCGATGGTGCCGCCTGGATCTGGAAAACCGCCGAATCCCTCTTTCCCGGAGCTCTCTGCAT
TGTGGACCGCTTCCATGCCAAGCAGCACCTCTCCGAACTCTCGAAGGCCCTCTTCGGCGACACTCCCAAGGCCAAGGAGTGGACCCATTGTCGCTACGAG
GAGCTCGATGAAGGTCGGATGGACGATCTGCTCAAGGAGATCGGAATCTACGCCTCCCGATTCCCGGAAGCCGCCCAATGCCGCACCTATTTTCAGAACA
ACCGGGAGCGAATGCGCTACCCGGAGTTCCGGGCCCTGGGGCTCTGTACCTCAAGCGGGGTCGTCGAGGCCGGCTGCAAGTCGATCGTCGGGGGCCGCCT
CAAAAAATCCGGCATGCACTGGAGCGTCGCCGGAGCCAACGCCATCCTGGCCCTGCGGTGCACGATCAAGAGCGGACGCTACGAGTCGTTCTGGGAGCGC
AAAGCCAGTCAATGGGCCGCCTGAATGGAGACATGCAATATAATGCAAAAAACAAAGACTTAAGACGATATATCTAAGTCCTAAAATTTGTCGCTCACCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1467 bp488 aa2581724+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MEAALRQKIGAAPKGSDEKRHLQELLSLLSGQKTPEAPPTASKAPTPSFASILEEVSQPMIRSSRRLDFGAMERAMKDRMLEETARTLESRLNEEITRHP
APFRCPACGRLLQSKGMKSKTFMTSLGEITLRRRYGFCRSCRKGSFPDDARLGLDETGVSPEVQYLAGLFGAETDFLRASDLLFCAARIRLPEKQVERLA
KSLGEQIAQDEREHVELEPHRLPQGPLYIGMDGTGVPIQSRETAGRRGKQKDGSSKTREAKMIDIWEAHTQNERGIPIRDPGSVSYSAAIESASCPDFAQ
MPSDFARRVEREASRRGAAQARQIVVIGDGAAWIWKTAESLFPGALCIVDRFHAKQHLSELSKALFGDTPKAKEWTHCRYEELDEGRMDDLLKEIGIYAS
RFPEAAQCRTYFQNNRERMRYPEFRALGLCTSSGVVEAGCKSIVGGRLKKSGMHWSVAGANAILALRCTIKSGRYESFWERKASQWAA

 

Blast result :
Comments
ISLfe1 is 44% aa similar to ISSiac4.
References
1] Guérillot R, Glaser P, (2013) Diversity of bacterial prokaryotic mutator like transposase, association with conjugation conjugative elements and insertion specificity (on preparation).
2] Goltsman,D.S., Denef,V.J., Singer,S.W., VerBerkmoes,N.C., Lefsrud,M., Mueller,R.S., Dick,G.J., Sun,C.L., Wheeler,K.E., Zemla,A., Baker,B.J., Hauser,L., Land,M., Shah,M.B., Thelen,M.P., Hettich,R.L. and Banfield,J.F. (2009) Appl. Environ. Microbiol. 75 (13), 4599-4615.