ISDere1

  • Family ISKra4
  • Group ISKra4
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_013223 ND Desulfohalobium retbaense
Desulfohalobium retbaense DSM 5692
DNA section
IS Length : 1553 bp

Ends


IR Length : 19/22

IRL : GGGTGCATTCGGTAGCTGCGACCGTTTTTAAAAAGTCAAATTGCCAAATA
IRR : GGGTGCATTCGCTACTTGCGACGACCCCCTTGACAAAGCGACAAGTGGGG

Insertion site


Left flankDirect repeatRight flankDR Length
TTATGAAGGACTTGCGGGAAATGACGCA8
CGGCCAGGCTCTTTTGGAGG0

DNA sequence

GGGTGCATTCGGTAGCTGCGACCGTTTTTAAAAAGTCAAATTGCCAAATAAGCAACTGTTATTTATTGAAAAGTTTCGGTAAATACTGTAATATCTCCGC
AAATCTACCGGAGGTATTACCATGCAGACTGCTCTAAATCAGAGTGATATTTATAAAGAACGTGCTCATCGGAAGTACTTTAGCGATATGAAAGAATTAT
TTGACAACGTATACGATATAATTGACGTACCCGGGCTGTCACTTTTTGAAAATATTGAAAAACTCTGTGAGCATAAGCTATACAATCTCGATCCAAAAAT
GCTGTCTGCGATCATTGAGACCAAGCTAGAGCATTACTTTTCTGGCTTCGAATGCCCTCTATGTGGTTGCAAGTGTTCTCATAATAAAAAATCAAAGAGA
CATATCGAAACCACTTACGGAACCGTATCATTTGATTCACCTTATTATAAATGCAAAAACTGCGATAAATTTTATGAACCGTACGTCTCTGCGTTGAACC
TTCGAAAGGGAAAGTACCAATACGACGTCCAAAAAATTGTCGCCAAAGTGGCCTCGTCGGTGCCTTTCGATGAAACAGCGGAAATCTTGTACGATACGCA
TGGCCTTTCCCTCTCCCAGGCTACAGTTCATGAGTTGACCAATGAACTAGCCGCCCATGCTCGACTTGAAGAGATCAGCCCAGAAGCAGCAACTATCCAT
GAGATTATCGAACAGGCTACCCGCCCCAATAAAGCCAGGCCGGTGCTTGTTTTCGCCGCAGATGGAGCCATGTCCCCAACTCGAACAGAAAAAGGCAAAC
CCAATGCGTGGAAAGAGGCCAAAGGTATACGGGTCTACTTGCTTGATGGGCAGCATTTAGCCCAAGTGCTGAGTTGGCATCAGATATGCGACAAACACCG
CTTCAAATCCTTTTTGCAGCAGATTAAACAGCAAAACCTTTTCCCGGAAGACAAAGTTCGGATCTGCTGTATAGGCGACGGAGCCGGGTGGATATGGGAG
GCGATGGAAGAGGCTTTTCCAGACGCACGGCAAATTTTGGATTATTACCATTGCCAAGAACATATCCACGAATTTGCCAACGCCCGCTTTGCTGACAAGG
CAGCCCGGGACAAGTGGCTGCGTGAAACGACAAATCGGCTCTTTCAAAATAAACTGAGCAGTGTTCTCGCTGGATTGAGGCGAATGAAGCTCACCGGCGA
GGCAGCAGAGAAGCGAGACGCTCTGTGCTCGTATTTGTCAAAGAACAAGGACCGCATGGATTACGGGAAAGCCAAGCGGGGCGGCTATCCTCTGGGCAGC
GGGGCCATAGAAAGCGCTAACAAATTTATAAGCCACATACGGCTCAAACGCTCAGGAGCCTGGTGGAAAGTCGACCTGGCTAACAATATCCTGGCCTTGC
GCTGTTCGAGGTACAACAAATCCTTCGATCGCTTCTTTGCCGCCTATGAAAAAAGCCAGCGGCAGGACTTAGGGTCGGCTCAGCCCCACTTGTCGCTTTG
TCAAGGGGGTCGTCGCAAGTAGCGAATGCACCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1401 bp466 aa1221522+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MQTALNQSDIYKERAHRKYFSDMKELFDNVYDIIDVPGLSLFENIEKLCEHKLYNLDPKMLSAIIETKLEHYFSGFECPLCGCKCSHNKKSKRHIETTYG
TVSFDSPYYKCKNCDKFYEPYVSALNLRKGKYQYDVQKIVAKVASSVPFDETAEILYDTHGLSLSQATVHELTNELAAHARLEEISPEAATIHEIIEQAT
RPNKARPVLVFAADGAMSPTRTEKGKPNAWKEAKGIRVYLLDGQHLAQVLSWHQICDKHRFKSFLQQIKQQNLFPEDKVRICCIGDGAGWIWEAMEEAFP
DARQILDYYHCQEHIHEFANARFADKAARDKWLRETTNRLFQNKLSSVLAGLRRMKLTGEAAEKRDALCSYLSKNKDRMDYGKAKRGGYPLGSGAIESAN
KFISHIRLKRSGAWWKVDLANNILALRCSRYNKSFDRFFAAYEKSQRQDLGSAQPHLSLCQGGRRK

 

Blast result :
Comments
ISDere1 is 40% aa similar to ISLfe1.
References
1] Guérillot R, Glaser P, (2013) Diversity of bacterial prokaryotic mutator like transposase, association with conjugation conjugative elements and insertion specificity (on preparation).
2] Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H., Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K., Ivanova,N., Mikhailova,N., Munk,A.C., Brettin,T., Detter,J.C., Han,C., Tapia,R., Larimer,F., Land,M., Hauser,L., Markowitz,V., Cheng,J.-F., Hugenholtz,P., Woyke,T., Wu,D., Spring,S., Klenk,H.-P. and Eisen,J.A. (2009) Direct submission GenBank.