ISHhy1

  • Family ISKra4
  • Group ISKra4
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_015510 ND Haliscomenobacter hydrossis
Haliscomenobacter hydrossis DSM 1100
DNA section
IS Length : 1356 bp

Ends


IR Length : 23/25

IRL : GGGTGCGGCTCTAGTTTGATGTAGAGAAAGAATAAAAATAGTATTTTGTG
IRR : GGGTGCGGCTCTAATTTGATGTACAATTAGGCTCTAATTTGATCGTAAAA

Insertion site


Left flankDirect repeatRight flankDR Length
ATCAACTAAAGTACCAACTCCTCCCCAA8
GAATGTGTAAAAGACAAGTTGAATTAGC8
ATCAATTGTAGAATGCGAGGGAGATTAT8
GTTGAACCATTCCCTATAGCCGCCAAGA8

DNA sequence

GGGTGCGGCTCTAGTTTGATGTAGAGAAAGAATAAAAATAGTATTTTGTGATCCAAGAACAAAAGGCTGATGGAAAAGTCATACAAAATAGAATCAGACG
GGAGTATAAGCATCACCTTCAATTTTAAACCAGAAGGGAGCATGCTGGAGCAAGAAGAGCAGATAGCGGCGGCGTTATCAGAGGCGGGTCGTCTAGCGAG
CGAACTATCGCTGAAAAGCTTCGATACGGGAGGAGAAAGCATTATCGTAAACAACGAAAAGCTGAGTAGTCGGGGTGAGGAAAAAAAACTACGAAACCGC
CTGGGGTCGAGTAAGCATTAGTCGCCATGTTTACCAGCGGAGTCGGGGAGGAAAAATATACGTTCCATTAGAAGTAGGGGCAAGGGTAGTTGGCGGAAAT
TGCACGCCGTATCTGAGTAAAATGGTGAGTTGGAAATACGCTCAATTAGCCGCATCGCGGGTCTGCGAGGACATGGCAATGCACCATCATCGAAGCATTA
GTCGGAAATTGGTACAAAAAATAGGGAGTGAGGTAGGTCTGATCGCCTGGGACAAAGAGATGGAGTGGTCATATGATTTACCTGAGCTAAAAGAGGTAGT
AAAGTGTGTGGCGATCAGCCGAGATGGGACGACGACACCGATTATTGGTCAGGGGTATCGAGAAACGATGTGCGGCACGATTAGTTTGTACAACAAAACT
GGAGATCGCCTTCATACCATTTATAAAGCGTGTGCCCCCGAAAAGGGTAAAGAAGGCTTTGATCGGGTCATGAACAAAGAGGTAGAGGAAATTAAAGCCT
TATTCCCTTCAGCCAAGTATGTTGGCTTGGCCGATGGAGCAGCCAATAACTGGACTTACCTCAATGGATGCACAACTGAGCAGGTTCTGGATTTTTACCA
TGCCACTGAGCACCTCAGCGAGGTGAGTGTGGCGATGGAACCAAACGAGGAACGACGTAAGAAGTGGCTGGATGAAGCCTGTCATGACTTGAAACACCGA
CCTAAAGCTGCGGTTTTTTTATTCAGAGAGCTCCAAGCCAAACAAAAAGAATATGGTGAGCATCCGCCGCAGGTATTATTGGACAACCTCACCTACTTGA
GTAACAACCTTAAACGAATGGACTACTGCCGATTCCTCAAAAACGGCTTCCCGATTGGATCAGGAGTTACTGAGGCAGCCTGCAAAGTCCTGGCCAAACA
ACGCTTGAGCGGTTCAGGTATGCGATGGCATCTCCATAAAGTACAAGATATGCTGTTGATTAGAGAACTCGTCTGTACAAGGGGGCGCTGGGAACAGTTC
TGGGCCTTTTACGATCAAATTAGAGCCTAATTGTACATCAAATTAGAGCCGCACCC
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
252 bp83 aa70321+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MEKSYKIESDGSISITFNFKPEGSMLEQEEQIAAALSEAGRLASELSLKSFDTGGESIIVNNEKLSSRGEEKKLRNRLGSSKH

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1065 bp354 aa2661330+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

VVGVRKKNYETAWGRVSISRHVYQRSRGGKIYVPLEVGARVVGGNCTPYLSKMVSWKYAQLAASRVCEDMAMHHHRSISRKLVQKIGSEVGLIAWDKEME
WSYDLPELKEVVKCVAISRDGTTTPIIGQGYRETMCGTISLYNKTGDRLHTIYKACAPEKGKEGFDRVMNKEVEEIKALFPSAKYVGLADGAANNWTYLN
GCTTEQVLDFYHATEHLSEVSVAMEPNEERRKKWLDEACHDLKHRPKAAVFLFRELQAKQKEYGEHPPQVLLDNLTYLSNNLKRMDYCRFLKNGFPIGSG
VTEAACKVLAKQRLSGSGMRWHLHKVQDMLLIRELVCTRGRWEQFWAFYDQIRA

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1261 bp420 aa701330+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MEKSYKIESDGSISITFNFKPEGSMLEQEEQIAAALSEAGRLASELSLKSFDTGGESIIVNNEKLSSRGEEKKNYETAWGRVSISRHVYQRSRGGKIYVP
LEVGARVVGGNCTPYLSKMVSWKYAQLAASRVCEDMAMHHHRSISRKLVQKIGSEVGLIAWDKEMEWSYDLPELKEVVKCVAISRDGTTTPIIGQGYRET
MCGTISLYNKTGDRLHTIYKACAPEKGKEGFDRVMNKEVEEIKALFPSAKYVGLADGAANNWTYLNGCTTEQVLDFYHATEHLSEVSVAMEPNEERRKKW
LDEACHDLKHRPKAAVFLFRELQAKQKEYGEHPPQVLLDNLTYLSNNLKRMDYCRFLKNGFPIGSGVTEAACKVLAKQRLSGSGMRWHLHKVQDMLLIRE
LVCTRGRWEQFWAFYDQIRA

 

Blast result :
Comments
ISHhy1 is 41% aa similar to ISDere1.
The third ORF is the putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
References
1] Guérillot R, Glaser P, (2013) Diversity of bacterial prokaryotic mutator like transposase, association with conjugation conjugative elements and insertion specificity (on preparation).
2] Daligault,H., Lapidus,A., Zeytun,A., Nolan,M., Lucas,S., Del Rio,T.G., Tice,H., Cheng,J.F., Tapia,R., Han,C., Goodwin,L., Pitluck,S., Liolios,K., Pagani,I., Ivanova,N., Huntemann,M., Mavromatis,K., Mikhailova,N., Pati,A., Chen,A., Palaniappan,K., Land,M., Hauser,L., Brambilla,E.M., Rohde,M., Verbarg,S., Goker,M., Bristow,J., Eisen,J.A., Markowitz,V., Hugenholtz,P., Kyrpides,N.C., Klenk,H.P. and Woyke,T. (2011) Stand Genomic Sci 4 (3), 352-360.