ISLdr1

  • Family ISKra4
  • Group ISKra4
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_JH413808.1 ND Legionella drancourtii
Legionella drancourtii LLAP12
DNA section
IS Length : 3746 bp

Ends


IR Length : 20/22

IRL : GGGTGTGACCTCGCATTAATGTTTTCTGTCAAAATCACTAAGAGCGAGAT
IRR : GGGTATGACCTCGAATTAATGTAAAGTTTACTTTAAATAACTAGCAAATT

Insertion site


Left flankDirect repeatRight flankDR Length
CAAAGCTTTTGATCTGTCTATCAAACTT8

DNA sequence

GGGTGTGACCTCGCATTAATGTTTTCTGTCAAAATCACTAAGAGCGAGATACGAGCCATTGCGCCACACCTGTTTATGTTATTTACATAACCATTTTGAA
CATGTATAATACATAAATTCATTGGCTAAGCTTTTATCCAGGAACCCCCATGCAAGACAAATCTGAAGTGACAATAGACATAGCTGGTTTACCCTCTGAA
ATGTGGAGTGAAGTCGTTAAACATTTACCAAAAGCTGGTTTATTCAATTTTTATCGAGCCTCAACAACGCATAAAGATTTATCTGCCTATGAGTTTAATA
GCCGTAAAGCGACACATACCTTTTTACGACATGTTGTATGCGGTGAGCATGAACAGGTTAAAGCCATGCTAGAGCAAGACATTGATTTGCTCTTTAAAAG
AGAGCAGGTAAGGGATTGCTCTGACCGAGTCTTTTTCGAAATTAGCGGCTTTGAATATGCACTTTGGGCCTTGGATAAACACATGTGGACGCTAATGCTT
GAGTGCATACCGCGAAATGAAAAGGGTAAAGAAGTTCTAGCGAGATTATCGACTCAATATAAGAAGCTTTGTGAAATGGGCGTTTCCTACAGCCTTCATG
AGAAACCAATCACTGAAACGCATTTTAATTTCGCAAATACCATCATTAAAGAGCTGCAAACGCAAGTGGATTCGATAAACGCGCCAGGGGATAAGAATTG
GGATGCCATTGATAAGCAGTGGCAAGAAGGTGTTGGTGGTGCGCAAAAACTACTGCCTATGCATGCTGTTGATGAGTACTGCTCTAATGAACCTTTTTAT
CCTGTACCTAAATTTACCTCACAACCAAAATCATCGAAACAATTCTATAATTGGACTACTGTAAAGGATGAAAATTGGTTTAGCGCTGATTCTAAGTTGG
CTATTGATTTTGCTATATATAAGGGCCGCCGGGGTGCGAGGGGGGCAGATGGAGTGGTCGAGGCGGGTGGCGATTTGGTTGCCTTAACGGCATTATGTGA
AGTAAGAACGAACGATTTTATCAATCTCAAATCAGAACTTGAAGAACAGATGACTTTGGATAATCGTCACCAAGTTTTTCAGATTTGACCGAGTTGGCCG
CATGTCGATGAAGAAGCTCGGCGGCGAATGCCGCCACATGCTCATCCCGGCATGAGTCCAAAAACCATAAAAGCAAGTCCTGGTATAACCAGTGTGCTGC
TGTTCTCACCCACCACATACACCATCGATGCAAGTAACTGATGATTCGCCGGGGAGAAACCCCATCTTTGACCATCCATTTAACTTGCTCGCGCGCTTTG
CGCAATGTTCTTGCATGAGGAACAATGTGTGTTTGCAAAAAAGGCTGCTCTTCGGGTTGCCAAATTGTCTCTACCCCCCCGATTTGGATGAGTTTTGCTC
TGTTTGTACCTTGTTAGAAACATTCAATGCAGCCTGTGTCGTTGTGGTGTTATCCAAAGGTCGTGTCTGTGGATATTGGATGCCTAAAAAATGAAAGCCC
TTATCAATTGAGCCAATACGTGTTTTTTTACCGGACAAGCCTAGACGCCTTTCTTGCAACACCTGCATCAGGCGCTGTTTACAGCGATTGAGGCTGCGCT
TGGTTTGGCACAGGATAAGAATATCATCCTGATACCGAAAATAAGCCACACCCATTTCATTGAATGCGTCATCGAGTGGTTTTAAATAAAGGGCACTAAA
AAATTGGGATAAAGGTCCCCGTAACGCAATGCCTGTATCCGGATTTTTATAACCTCTTGGCGTTTCAATTGGATTGACTATAATACGTTCCAACATCAAA
TTTAGTTTAGGATCATGGTAATGTGCCTGAATATCCTTGACTAATTGATGATGTGATATGGATTTGTAATAGGATTTAATATCGGCGCGAATAAGATATT
TTGGCTTTTTTTCTTCGAGAACCTTTCTCACTTCCTGTGTTGCATGCTTTACTCCACTCGGACCAAGAAGGTGATAACAATTAGGGTTCATGACAAAAGG
AAATGTGGGCTTTAATTGGTGCAGCAAAACATGTTGCAGAATACGGTCGGAAAGATGGAGTTGGTCAATCATTTCGTCTGGAAAATAACAACGCTTAAGG
AATCGTGGTGTATAACTGCCATCGATTAGGGCATGAATACCATTAACTAACCAATCATCCAATTCTCGTGCTAAAAAATGAATGTCGTGGTTATGATGGG
CATGATGTTTTTGTTTATGGATCTTGGCAAACAGTTTTTGGCCAATATCCAGCATTGAAGTCAGCTCCCAACGCTTCATACTTTGTTTTTATCCTTGTTC
AATTCAGGCGTTCATTTATCTGCTTTTATGCATGAAATAGCCAATAACTAACACTCTGAATCTTGACTGTCTAGTTAGGTATTATATCATCACCATTTTA
AAATGGATTTGTAGTAATTGATATGGCTAAAGTGATTGCTGTAAACAATGATGAAATAGTGTTGCAAGTACGAGTCAAACTTAATGGTTCCATGCTGAAT
ATGGAAGAGGCAATTCAAGCCGCTGTCAATGAAGTGGGTAGTCTTGCAACAACAGAGGCATTAAAGCGGTTTGATACAATTGGGGCTCCTATGCAAATAG
GCAATGTCCGGGTGACGAGCAAAGGAAAAGTCCAAAAATGTTATGAAACACCTTATGGTGCTATTCACCTGGAGCGTTATGTTTATCAAACCTCATCTGG
AGGAAAAACCTACTGTCCTTTGGATGAACGAGCACGAATTATCATCAGTTCAACGCCACGATTTGCTAAACAAGTTTCTAGCAAATACGCACAATTAAGT
GCACAAGAAGTCCTGGACGATTTTAAAACCAATCATGGCCGACCAGTAGCCCGTTCTTTTTTACAAAATATTGTGGATGTGGTTGGCTCAATTGCTCGAG
CTACGGAAACAGACTGGATGTTTGAAACGCCCAAACTCAATGACGTTGTTACCACTGTATCCGTAAGTCTTGATGGTACTTGTGTCCTCATGGTGAATGA
AGGTTGGCGAGAAGCTATGACAGGAACAATTACCTTATATAATAAGGTTGGAGAACGGTTGCATACTATTTATTTAGGGGCAGCGCCAGAATATGGCAAG
ACGAAATTTTTGGAGCGTCTTGAGCGAGAGGTTTACCGCATTAAATTGCAATACCCTAACGCAACTTATGTCGGTATTGCTGATGGTGCAAGAGTCAATT
GGGATTTTTTAGAACGGCATACCCAATATCAAGTTCTAGATTTTTTTCATGCAACCGAATATCTTGCAAAAGCCTCTCATGCCATGCACCCGGTAGATAC
GAAACAAAGAAAAATTTGGCTCGATTTAGCATGTCATCGATTAAAACATGAGCTTAATGCAGCCTCTGAATTGCTTAATGAAATGAGCAACATGCCACCC
AATAGGAAAAAAAAGGAGCTTGTGGACAAACTAAAAAGTGCAATTACCTATTTTAAAAACCAAAGACAACGTATGGATTACAACTTCTATCAGATAAAAA
ATTTGCCCATTGGCTCGGGAGTTACCGAAGCAGCTTGTAAGACTCTCATTAAACAGCGTCTTTGCCAGTCTGGAATGAAGTGGAAAAATCAGGGTATTTC
AATGGTGCTGCATTTAAGAGCATTGATATCAACCAAAGGTCGTTGGGAACAATTTTGGGATCGTATTAATCAAGCAGGATTAATTGGATTGGCGGAAATT
TGCTAGTTATTTAAAGTAAACTTTACATTAATTCGAGGTCATACCC
Protein section
ORF number : 4

 

ORF 1
LengthBeginEndStrandFusion ORF
939 bp312 aa1501088+No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MQDKSEVTIDIAGLPSEMWSEVVKHLPKAGLFNFYRASTTHKDLSAYEFNSRKATHTFLRHVVCGEHEQVKAMLEQDIDLLFKREQVRDCSDRVFFEISG
FEYALWALDKHMWTLMLECIPRNEKGKEVLARLSTQYKKLCEMGVSYSLHEKPITETHFNFANTIIKELQTQVDSINAPGDKNWDAIDKQWQEGVGGAQK
LLPMHAVDEYCSNEPFYPVPKFTSQPKSSKQFYNWTTVKDENWFSADSKLAIDFAIYKGRRGARGADGVVEAGGDLVALTALCEVRTNDFINLKSELEEQ
MTLDNRHQVFQI

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
114 bp37 aa11281241+No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MPPHAHPGMSPKTIKASPGITSVLLFSPTTYTIDASN

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
909 bp302 aa22791371-No
ORF function : Passenger Gene
Annotation : Reverse transcriptaseDescription :

ORF sequence :

MKRWELTSMLDIGQKLFAKIHKQKHHAHHNHDIHFLARELDDWLVNGIHALIDGSYTPRFLKRCYFPDEMIDQLHLSDRILQHVLLHQLKPTFPFVMNPN
CYHLLGPSGVKHATQEVRKVLEEKKPKYLIRADIKSYYKSISHHQLVKDIQAHYHDPKLNLMLERIIVNPIETPRGYKNPDTGIALRGPLSQFFSALYLK
PLDDAFNEMGVAYFRYQDDILILCQTKRSLNRCKQRLMQVLQERRLGLSGKKTRIGSIDKGFHFLGIQYPQTRPLDNTTTTQAALNVSNKVQTEQNSSKS
GG

 

Blast result :
ORF 4
LengthBeginEndStrandFusion ORF
1284 bp427 aa24233706+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MAKVIAVNNDEIVLQVRVKLNGSMLNMEEAIQAAVNEVGSLATTEALKRFDTIGAPMQIGNVRVTSKGKVQKCYETPYGAIHLERYVYQTSSGGKTYCPL
DERARIIISSTPRFAKQVSSKYAQLSAQEVLDDFKTNHGRPVARSFLQNIVDVVGSIARATETDWMFETPKLNDVVTTVSVSLDGTCVLMVNEGWREAMT
GTITLYNKVGERLHTIYLGAAPEYGKTKFLERLEREVYRIKLQYPNATYVGIADGARVNWDFLERHTQYQVLDFFHATEYLAKASHAMHPVDTKQRKIWL
DLACHRLKHELNAASELLNEMSNMPPNRKKKELVDKLKSAITYFKNQRQRMDYNFYQIKNLPIGSGVTEAACKTLIKQRLCQSGMKWKNQGISMVLHLRA
LISTKGRWEQFWDRINQAGLIGLAEIC

 

Blast result :
Comments
The transposase is the fourth ORF.
ORFA, ORFB and ORFC are passenger genes annotated respectively as hypothetical protein, hypothetical protein and reverse transcriptase.
References
1] Guérillot R, Glaser P, (2013) Diversity of bacterial prokaryotic mutator like transposase, association with conjugation conjugative elements and insertion specificity (on preparation).
2] Gimenez,G., Bertelli,C., Moliner,C., Robert,C., Raoult,D., Fournier,P.E. and Greub,G. (2011) Direct submission GenBank.