ISFsp17

  • Family ISKra4
  • Group ISKra4
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_009921 ND Frankia sp.
Frankia sp. EAN1pec
DNA section
IS Length : 1693 bp

Ends


IR Length : 22/28

IRL : GGGTGTAGTTCCGGCCGAGTGAGATCATTGCGATAGCGATCATCGAGTGC
IRR : GGGCGTAGTTCCCGCCAAGTGACGTGATCAAGTCGGTGTGTAGTGTTCGG

Insertion site


Left flankDirect repeatRight flankDR Length
GTTCTGACGTATTTTAGTTA0

DNA sequence

GGGTGTAGTTCCGGCCGAGTGAGATCATTGCGATAGCGATCATCGAGTGCTGTGCCAGGGTTGATCAAGAAGGTGGCTCCTTCTCGCTACGTTCCGTGGT
GACGAAACCATTGGGACGTGACTGCGAAAAGGAGCCTGCGTGTCAGGGTACGAGGAGCCGGCCGTGCCGCCGCCGGCGGGCCCGTTCGCCGAGGCCAGGG
CGCGGTACCTCGCGCTGGAGGCGCTGCTCGCCGGGGCGGACGCCCGCGCTGGCCGGCACGACGAGGTCGAGGACCTGATCGAGCGGGATGGCCGTGAGGT
GCTGCGGGCGCTGCTGCAGGGCCATCTTGACCTGCGTGCCCGTGAGGAGACGCGGGCCGACCCGCCACCGGTCGGTGCTGACGGGGTGGCCCGTACCCGG
CTGGAACGCGGCCATGGCCGGCGGCTGGTGTCCCAGTTCGGGCAGGTCGTGGTCAGCCGGCACGCCTACCGGGCGGCGGGGGCGGGCAACCTGCATCCCG
CGGACGCGGTGCTGAACCTTCCGGCGGGGCTGTACTCGCACACGCTCGCGCGCAGGCTCGCCCTGGAGGTGACCCGGGGCTCGTTCGACGACGCGGTCGA
CGCGGTCGCCCGCGCGACCGGCCAGGTGATGGGCAAACGGCTCGCCGTCGAGCTCGTCCGGAGCCTGGCCGCCGACATCACCGCCTTCTACGCCCAGCCA
CGGCCCGAGATCACCCCCGCCGGCCGGCTGCTGGTCCTCCAGTTCGACGGCAAGGGCATCGTCATGCGCCCCGAGGCGCTGCGCCCGGCGACCGCGAAGG
CCGCCGAGGCGAGGAAGAACCGGCTGGCCACCCGGCTGTCACCCGGCGAGAAAGCCAACCGCAAACGGATGGCCGAGATCGCCATCGTGCACGACACCAC
CCCCGCGCCGCGCACCGTCGACGACGTCATCCCCCGCCGCGGCAACGCCCAGGCCAGCGGCCAGCCCCGGGCGGACGGGCCGACGGCCACCGGGACCTGG
CTGGCCGCCTCCGTCGTCGACGACATCGCCACCGTCATCGCCGCCGGCTTCGACGAGGCCGAACGCCGCGACCCCCACCAGCAGCGGACCTGGGTCGTGC
TCGTCGACGGCAACAACACCCAGCTCGACGCGATCCACGCCGAGGCCACCCGCCGCGACGTCACCATCACCGTCATCGTCGACTTCATCCACGTCCTCGA
GTACCTCTGGACCGCCGCCTGGTCGTTCTTCGACAAGGGCGACCCCGACGCCGAGGACTGGGTCCACGCACAGGCCCGCGGCGTGCTCGCCGGCAAGGCC
CACGCGATCGCCTCCGGGTTCCGCCGCCGCGCGACCCGCAACCACTACAACGCCACCGAACGCAAGGGCGCCGACACCGCCGCCGACTACCTCGACGCCA
AGGCCCCCTACCTGGGCTACGACCTCGCGCTCGCCAACGGCTGGCCGATCGCGACCGGCGTCGTCGAGGGCTCCTGCCGCCACCTCATCAAGGACCGATT
CGACATCACCGGAGCCAGATGGGGCCTCGACGGCGCCGAAGCAGTCCTCCTCCTCCGCGCAGTCGTCACCAACGGCGACTTCGACGCCTACTGGGCTTAC
CACCTCGACCAGGAACAGCACCGCAACCACCACACCAAGTTCGCCGAACACTACACACCGACTTGATCACGTCACTTGGCGGGAACTACGCCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1503 bp500 aa1641666+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MPPPAGPFAEARARYLALEALLAGADARAGRHDEVEDLIERDGREVLRALLQGHLDLRAREETRADPPPVGADGVARTRLERGHGRRLVSQFGQVVVSRH
AYRAAGAGNLHPADAVLNLPAGLYSHTLARRLALEVTRGSFDDAVDAVARATGQVMGKRLAVELVRSLAADITAFYAQPRPEITPAGRLLVLQFDGKGIV
MRPEALRPATAKAAEARKNRLATRLSPGEKANRKRMAEIAIVHDTTPAPRTVDDVIPRRGNAQASGQPRADGPTATGTWLAASVVDDIATVIAAGFDEAE
RRDPHQQRTWVVLVDGNNTQLDAIHAEATRRDVTITVIVDFIHVLEYLWTAAWSFFDKGDPDAEDWVHAQARGVLAGKAHAIASGFRRRATRNHYNATER
KGADTAADYLDAKAPYLGYDLALANGWPIATGVVEGSCRHLIKDRFDITGARWGLDGAEAVLLLRAVVTNGDFDAYWAYHLDQEQHRNHHTKFAEHYTPT
C

 

Blast result :
Comments
ISFsp17 is 45% aa similar to ISDpr10.
References
1] ISfinder annotation (2013)
2] Copeland,A., Lucas,S., Lapidus,A., Barry,K., Glavina del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Saunders,E., Brettin,T., Bruce,D., Detter,J.C., Han,C., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Kim,E. and Richardson,P. (2007) Direct submission GenBank.