ISDssp4

  • Family IS1380
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
FR695868 ND Desulfobacterium sp.
Desulfobacterium sp.
DNA section
IS Length : 1597 bp

Ends


IR Length : 16

IRL : CCCAAAATCCGCTATTAACGCGAAAATTTATGAAATAAATATTGAAAAAC
IRR : CCCAAAATCCGCTATTGCTTTTCATAAAGGTACTCTTTTGGCTTTATCAA

Insertion site


Left flankDirect repeatRight flankDR Length
CACTTTTATAATATATTTTAATTATT6

DNA sequence

CCCAAAATCCGCTATTAACGCGAAAATTTATGAAATAAATATTGAAAAACCTCGTTGATTCAAATAGATATGTGTTATCAAGACAGCATAAATATTTAAC
CAACGAGGTTATGGATATGATAAAACAAACTGTGTTACCATTCAAGATAGAAATTACGAAAGATATGATAACATCACATGCAGGGCTGGCGCTATTGGGG
GAATTTGCGGTTGGGTTGAGATTATTGGAAGCTATTGACAAAAATCTGCCTGCGCCCGGTAGTGGTGCCGGATACAGTGCGAGTGAACATATATTGCCAC
TCATATTGATGTTAAATGGCGGAGGTCGAAGCCTGGAAGATTTGCGGCAAATCCGGAAAGATGATGGTTTGCGAGAAGTATTGCCATTGAAACGTATGCC
ATCATCGGATGCTACGGGGGACTGGTTGCGTAGAAGTGGTATAAACGGTTCACTTAAAGGCCTTGCTGAGGTAAATCGCAAGATAATAAAGCGTGGTCTC
AAGTATGACGGGATCAAAGGCTATACGCTGGATATTGATGCAACCGGAATTGAGGCAGAGAAAGAGTTAGCTAAGATGACTTATAAAGGATATCTTGGTT
ACATGCCTATGGTGGGCCATTTAGCGGAAAACGGTTTTGTTTTGGGAGATGAATTTCGTCAGGGCAACGAAGCTCCGGCGTCAAGAAATCTTGAGTTTAT
AAAGTATTGTAAGAAGCAATTGCCCAGTGGCAAACATATCAAGGCATTCAGGGCAGACAGTGCAGCCTATCAGGCGGATATAATCAATTATTGTCATGGT
AATGGGATAAAGTTTGCTATTGGAGCAGATCTGGATAAGGCGGTTGTCAGACAAATCAAAAGCCTTGGGGACAGTGATTGGAGAGTTTATCAAAATGGCT
TTATTGCTGAGACGGTGCATTGTATGAATAAAACAAAGCAGTCATTTCGTCTGGTAGTAATTCGTCGTCCCATTCAGGTAAAGTTATTTAATGAAACAGA
TGAAAAAGAGAAATACACAGTAATAGCGACAAATCGCACTGAAGATGTTGAGCAGGTGGTGAGATGGTACAGCCAGCGCGGACAGTGCAGTGAGAACCGG
ATTAAAGAACTTAAGATCGGTTTTGGCATGGAAAGGATGCCGTGCGGTCAGTTTGAGGCTAATGCGGTATTTTTTCGTATCGGAGTATTGGCATATAATG
TTGGCCGGTTATTTGTGCTAAAAACGTTGGACAAGTCGTGGCATAGTCATCAAGTTCAAACTTTAAGATGGAAGCTATATGAAACGGCCGGCAAGATAGT
TTTTCATGGAGGAGTTATATGGTTAAAAGTCAGGCGTCATTATCAAGCCCTGTTTTCGGAGATACGATTGAAAAGCTGGGAGTTTTCCACCGGATAAAGG
AAAAAAGAAATACAATGATTTGGAATCAAAGTGTAGAGGTGCGTCCAAATGGAGCCATAAATTAAATTTATTGGCAATATGGCTTGCTTTCCCCTAATAC
AAAGGCTTATACAAAGCGTTTTTTATCGTCTGTACTGATTTTTTTATTTGATAAAGCCAAAAGAGTACCTTTATGAAAAGCAATAGCGGATTTTGGG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1356 bp451 aa421397+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKNLVDSNRYVLSRQHKYLTNEVMDMIKQTVLPFKIEITKDMITSHAGLALLGEFAVGLRLLEAIDKNLPAPGSGAGYSASEHILPLILMLNGGGRSLED
LRQIRKDDGLREVLPLKRMPSSDATGDWLRRSGINGSLKGLAEVNRKIIKRGLKYDGIKGYTLDIDATGIEAEKELAKMTYKGYLGYMPMVGHLAENGFV
LGDEFRQGNEAPASRNLEFIKYCKKQLPSGKHIKAFRADSAAYQADIINYCHGNGIKFAIGADLDKAVVRQIKSLGDSDWRVYQNGFIAETVHCMNKTKQ
SFRLVVIRRPIQVKLFNETDEKEKYTVIATNRTEDVEQVVRWYSQRGQCSENRIKELKIGFGMERMPCGQFEANAVFFRIGVLAYNVGRLFVLKTLDKSW
HSHQVQTLRWKLYETAGKIVFHGGVIWLKVRRHYQALFSEIRLKSWEFSTG

 

Blast result :
Comments
ISDssp4 is 66% aa similar to ISLsp3. This IS is found in Uncultured Desulfobacterium sp.
References
1] ISfinder annotation (2013)
2] Bergmann,F., Selesi,D., Weinmaier,T., Tischler,P., Rattei,T. and Meckenstock,R.U. (2011) Environ. Microbiol. 13 (5), 1125-1137.