ISHla11

  • Family ISH3
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP001366 ND Halorubrum lacusprofundi
Halorubrum lacusprofundi ATCC 49239
Halophilic archaeon DL31
Halophilic archaeon DL31 plasmid phalar01
halophilic archaeon DL1
DNA section
IS Length : 1376 bp

Ends


IR Length : 16/17

IRL : CAGTCGATCACATCGGGTTAGAGTAAGTGTCTGCTTGGGTGCGGTGTGAA
IRR : CAGTCGATCACATCGAGAATTCTCTACCCCCTCCAGTAGAGGTTGAATTT

Insertion site


Left flankDirect repeatRight flankDR Length
GCGCTCCAAGTGATGTTGGGACACGTTCT5
GGTGGTCATGATAGTATATGCTAGGTCACTACGT0
ACGTCCGGAACCATT/ACTAGATCTAAATCG7

DNA sequence

CAGTCGATCACATCGGGTTAGAGTAAGTGTCTGCTTGGGTGCGGTGTGAAGCCTACCCAGGCAGACAGCGAGATAGAGGAAGAGCACCTGCTTAATTGTG
TCGTCAACAGCCTCGACGAGGAACTTGCGATAGACCTCGGCGAGAATGTCGAGGTCACGACAGAGACGTTGTACGAGGTCCTCGCCGGCGCCAGCGCCGG
CGGGACCTCAATCAACCACGTCTGCGAAACAACTGACGACTCGCCCCACGCCAATACCGTCCGTGGACATCTCACCGACCAGTTTGAGCTGGACTCCGTT
GAGGCGGTTGGGGACACACTCCTGCAACGAGATACTCTTGAGACACTGCCGGATCGGCCGGTGGAGGTCGTCGCCGACCTCCACCTGGATCCTTACTACG
GTGACGAGGACGAGACAGAGGCGCTGTACTCCTCGCAGGCTAAACGCGGAACCACGGCGTTTCACGCGTATGCGACGCTCTATGCGCGGGTACGAAACAA
GCGGTACACGCTGGCGGTTCGCCAGTTAGTCGCTGGCGAGACCACCAGCGATGTCCTCGCTGAGTTTCTTGAACTGCTTGACGGCCTTGACCTCGGCGTC
AAGGCCGTCTACCTCGATCGCGGATTCTACAACAGCACCGGTCTCAAACTGCTGTACGCGCACAACTACGCCTACGTGATGCCGATTGTCAAGTGGGGCG
AAACGATTCAGGACGAACTCAACAGCGGCTGGAGCCGCGAGATTGAACACGATCTCGCCGGCGAGGTGACGTTTCCTGTGTTCATCGACTGTGTTTACCA
GCAAGGACGGTGCGACGAACACGGGGTGGCGCGTCACGGCTACGCCGCTGACGCGCCGTTCATCGACACGCCACGAGATGCCCGAAACCACTACAGCAAA
CGCTTCGGCATCGAGTCGAGCTACCGATTAGCCAAGCAGAGCCTCGCGTTCACCAGTTCTCAGGATGCTGGACTGCGGCTGGTGATGTTTGTAGTGAGCC
TATTGCTTCAGAACAGCTGGCGGTATCTTCACTGGAGGTACGTGGCGGCGCCCCGCCGCGGGGGGCGCCGCCTCTGGAGATGGTCGTTCACGGAGTTCTG
TGAGATGGTGCTGCGGGCAGCCTGGACAGCGCTTGGTGTGCGCAGGTCTGTTCCAGCGAACCAACCACTCGACGACCGGTTCTTCCGGTAGCTGTCCACC
GCTCGGGACAGCAATCGTGAGTGGCGACACTGTCGCGTCGGCGGCAGTCCGCCGCCGACAGCGACCCCTCACCGCCGAAACTCACCGTCCGTGTCATTTC
GAGAATTGACCACGCATCGAAGACGCAAATTCAACCTCTACTGGAGGGGGTAGAGAATTCTCGATGTGATCGACTG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1146 bp381 aa461191+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKPTQADSEIEEEHLLNCVVNSLDEELAIDLGENVEVTTETLYEVLAGASAGGTSINHVCETTDDSPHANTVRGHLTDQFELDSVEAVGDTLLQRDTLET
LPDRPVEVVADLHLDPYYGDEDETEALYSSQAKRGTTAFHAYATLYARVRNKRYTLAVRQLVAGETTSDVLAEFLELLDGLDLGVKAVYLDRGFYNSTGL
KLLYAHNYAYVMPIVKWGETIQDELNSGWSREIEHDLAGEVTFPVFIDCVYQQGRCDEHGVARHGYAADAPFIDTPRDARNHYSKRFGIESSYRLAKQSL
AFTSSQDAGLRLVMFVVSLLLQNSWRYLHWRYVAAPRRGGRRLWRWSFTEFCEMVLRAAWTALGVRRSVPANQPLDDRFFR

 

Blast result :
Comments
ISHla11 is 95% aa similar to ISH20A.
References
1] F. Pfeiffer (2013) Direct submission
2] Lucas,S., Han,J., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S., Peters,L., Mikhailova,N., Teshima,H., Detter,J.C., Han,C., Tapia,R., Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Pagani,I., Dyall-Smith,M., Cavicchioli,R. and Woyke,T. (2009) Direct submission GenBank.