ISH35

  • Family IS200/IS605
  • Group IS605
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AM774418 ND Halobacterium salinarum
Halobacterium salinarum R1 (DSM 671) plasmid pHS3
DNA section
IS Length : 1836 bp

Ends


Left end : AAAGATACGAGCGCATACCCCCGTCTTTAGGCGGGGGTCAAGCGGACCATAGCCTACACACCCACCGACGATGCCACGAATGGATTTCCAACCGTTCTAT II struct. : Yes
Right end : GGAGACGCTTGGGACGTATGCGTCTTGAAACCATAGGGCCACGCCCGGCCTGAAATCCCGTGGTGGGATTCCCGCGTCTTCAGGCGCGGGAGGAGGTCAA II struct. : Yes

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
AGTCGAGCGGGGTGATTACGGGCGGCTCTCAA

DNA sequence

AAAGATACGAGCGCATACCCCCGTCTTTAGGCGGGGGTCAAGCGGACCATAGCCTACACACCCACCGACGATGCCACGAATGGATTTCCAACCGTTCTAT
CGGTAATATTAAGACGCCAACGGACCATAGTGTGCAGCACGGATGAAGACCACACGGCACGCGACCTACAACCTCAACTACCACATCGTGTGGTTGCCGA
AGTACCGCCAGTCGGTACTCGTCAACGAGGTCGCCAGTCGTGTCCGGTCCATCCTCCACGAAATAGCCGCCGACAAAGGCGTCGAAATACTCGACCTCAC
CGTACAGCACGACCACGTTCACCTGTTCGTCAGTAGCCCACCCAAGAACGAACCGGCACTACTCGCCAATTGGTTCAAGGGCATCTCCTCACGCAAGTAC
AACCACCGATACGCCGACCACGACGGCGAGAAAATCGGATGGGCGCGAGGATACTACGCAGGGACCGCCGGGCACGTTTCGAGCGAGACAGTCGAGAACT
ACATCCAGCAACACAAGGAGGGCGATTCGTGACCGAACTCACGAAGACGCTCGAACTTAAACTGGTAGAGCCGAACGCCCACAAGCGGAGGAAACTTCGT
GAGACGCGAGAGGCGTACCAGCAAGCCCTCCAAGACGCTTTCGACGCCGGATGTACCACGCAGACCGAAGCGAACGACGTGGTGGTCAACTACGACCTGA
GCGGGTACGCGAAGAACGCGCTCAAGAAGTACGTCCCGCAACTCACGACGACGTACAACGCGGGCGAACTTCACGACGACCACCCCGTCCGCTTCACGAA
CGGAGGGCTACGACTCGACCACAAGCCCGAGAACGCCATCGAGTGGTACGTCAAAATCCCGCACCACGAGGACTACCACCTCTGGATGCCAGCACAGCCG
AACCCTGAACAGCGGGACTGGTTGGAAGCGTTGAACGCGGGAGACGCCACGATGGGCGAAAGTCGGCTGTTCGAGCGGGACGGAACGTGGTATCTCCACG
TCACCGCCACCCGCGACGTAGAGGAACGCTCCGATGTGTCCGCCGAAGAACGGACGCCCATCGGAGTGGACATCGGGGAAGCGTCACTCGCCACGGTGTG
TCACCGCGACGGCCACGGTTCTCCGACCGCGCCCGAACTGTGGGCCGACGAGGGCAAGACCGTTCGTCGGCTCCGCAAGACCTACTTCACCGCCACACGA
CGACTCCAGACGCGCGGAAGCGAGCGTATCGTGGAGTCCTTCGGGGACGACATATGGGACCAGATAGACGACGTATTCCACCGCGTCACCCGCGAGGTCG
TGGAGTACGCCGAGTCCGTCGAGAACCCGGTTCTCGTTTTAGAAGACCTGACGTACATACGGGAGTCGATGGACTACGGTGAGTACATGAATCGGCGTCT
CCACGGATGGGGATTCGCCAAACTCCACGCGCAGATACGCTACAAGGCCGTCGAGAAGGGCATCCCCGTCGAGACGGTGAACCCGTGCAACACGTCGAAA
GAGTGCCACGCTTGCGGTGAAGTGGGGTATCGCCCGCGACAGGCGACGTTCAAGTGTACGAACGACGCTTGCTGGATGGGCGAGTCCCAAGCGGACGTGA
ACGGCGCGATAAACATCGCAGACCGCTACCTCAGCGGAGAGAGCCATTCAAGAGAACACACGGATGGCGATGACTCGGCTGGGGATGGGGGGCGTTTGAC
CGCCCCGCAAGACACCCTAGCCGATGCTACCACGCAGGAGACGCTTGGGACGTATGCGTCTTGAAACCATAGGGCCACGCCCGGCCTGAAATCCCGTGGT
GGGATTCCCGCGTCTTCAGGCGCGGGAGGAGGTCAA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
390 bp129 aa143532+No
ORF function : Transposase
Chemistry : Y1

ORF sequence :

MKTTRHATYNLNYHIVWLPKYRQSVLVNEVASRVRSILHEIAADKGVEILDLTVQHDHVHLFVSSPPKNEPALLANWFKGISSRKYNHRYADHDGEKIGW
ARGYYAGTAGHVSSETVENYIQQHKEGDS

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1236 bp411 aa5291764+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MTELTKTLELKLVEPNAHKRRKLRETREAYQQALQDAFDAGCTTQTEANDVVVNYDLSGYAKNALKKYVPQLTTTYNAGELHDDHPVRFTNGGLRLDHKP
ENAIEWYVKIPHHEDYHLWMPAQPNPEQRDWLEALNAGDATMGESRLFERDGTWYLHVTATRDVEERSDVSAEERTPIGVDIGEASLATVCHRDGHGSPT
APELWADEGKTVRRLRKTYFTATRRLQTRGSERIVESFGDDIWDQIDDVFHRVTREVVEYAESVENPVLVLEDLTYIRESMDYGEYMNRRLHGWGFAKLH
AQIRYKAVEKGIPVETVNPCNTSKECHACGEVGYRPRQATFKCTNDACWMGESQADVNGAINIADRYLSGESHSREHTDGDDSAGDGGRLTAPQDTLADA
TTQETLGTYAS

 

Blast result :
Comments
ISH35 is 96% (TnpA : the transposase) and 95% (TnpB) aa similar to ISNpe10.
References
1] Pfeiffer F., Schuster S.C., Broicher A., Falb M., Palm P., Rodewald K., Ruepp.A., Soppa J., Tittor J., Oesterhelt D. (2008) Genomics 91: 335-346.