ISHxa2

  • Family IS5
  • Group ISH1
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_015658 ND Halopiger xanaduensis
Halopiger xanaduensis SH-6 plasmid pHALXA01
DNA section
IS Length : 947 bp

Ends


IR Length : 14/18

IRL : GGCTCTGTTGAAATCCTCAGAGAGTTATATGTTCGCCGTGTAATTTCACG
IRR : AGCTCTGTTGAACCCTTCTCCTTCAGATACAACAAGATATGACCTCCTGT

Insertion site


Left flankDirect repeatRight flankDR Length
TCCACCGTCTAAATAAACGC0

DNA sequence

GGCTCTGTTGAAATCCTCAGAGAGTTATATGTTCGCCGTGTAATTTCACGAGATGAAGGCCCTCCCGAAGTCGCAGATTCTCCGTTTTACTGAGAAGGCG
ATCCATCTGGCACGCCGAGCCGTCTCTCGATACTCTTCGAAGTTCTCTAAACACCGCTATACACTCCCGCAGCACGTTGTTCTGCTATGTCTCAAAGTTC
GGAAGAACACGACCTATCGTGGTTTGCTTGACGAATTGATCGAGATGCCACGTATCCGTCGTGTTCTCGGGCTAGCCGAGCTTCCTACGCCATCAACGCT
TTGTAAGGCATTCAACCGGCTTGATATGGCTGTATGGCGTGTTATATTGACTCTCTCAGCGACGCTACTTCCGACGAGCGGAGTTGTTGGTGTTGATGCG
TCGGGATTCGACCGTAGTCACGCTTCGAAACACTACACGAAACGCGCCGAACTCACGATTCAGCAGTTCAAGGTGACGTTGCTGGTCGATGCGAAAGTAA
ATACGATTCTCGATTTACACGTGACGACGACTCGAAAACATGATAGCCAGATTGCTCCGTCGTTGATCAAGCGCAACCCCGAAGATATTGACATTCTGCT
CGGTGACAAGGGCTACGACGACCAGAAAATCAGGCGACTTGCTCGGCAACACGAGGTTCGGCCACTGATTAAGCATCGTGAGTTCACGTCACTCCACCGA
GCATGGAACGCACGCTTAAACGCTGATCTCTACGGGCAACGGAGTCAATCTGAGACAGTCAACTCGACGCTCAAACGAAAGTACGGTGCGTTCGTCCGAT
CACGACGCTGGTGGAAACAGTTCCGTGAACTCACCATCGTCTGTCTCGTTCATAATCTCGACCGGTCGCTCTGAGCGGTCTATACATTATATTAGCCACA
GGAGGTCATATCTTGTTGTATCTGAAGGAGAAGGGTTCAACAGAGCT
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
822 bp273 aa53874+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKALPKSQILRFTEKAIHLARRAVSRYSSKFSKHRYTLPQHVVLLCLKVRKNTTYRGLLDELIEMPRIRRVLGLAELPTPSTLCKAFNRLDMAVWRVILT
LSATLLPTSGVVGVDASGFDRSHASKHYTKRAELTIQQFKVTLLVDAKVNTILDLHVTTTRKHDSQIAPSLIKRNPEDIDILLGDKGYDDQKIRRLARQH
EVRPLIKHREFTSLHRAWNARLNADLYGQRSQSETVNSTLKRKYGAFVRSRRWWKQFRELTIVCLVHNLDRSL

 

Blast result :
Comments
ISHxa2 is 97% aa similar to ISHla4.
References
1] ISfinder annotation (2014)
2] Lucas,S., Han,J., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S., Peters,L., Mikhailova,N., Teshima,H., Detter,J.C., Han,C., Tapia,R., Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Pagani,I., Anderson,I. and Woyke,T. (2011) Direct submission GenBank.