ISPa53

  • Family IS110
  • Group IS1111
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
FJ917747 ND Pseudomonas aeruginosa
Pseudomonas aeruginosa PA601
DNA section
IS Length : 1381 bp

Ends


IR Length : 12/13

IRL : tgctgtaATGGACTTTCCCCGCGCCACAGTTCTATACCGAGAACGGTGGT
IRR : ---atatATGGACTCTCCCCACAAGTAGCGGGCAAAGCTTTTCTTTTGCA

Insertion site


Left flankDirect repeatRight flankDR Length
TCGGCTTGAAGAGTTGTTAG0

DNA sequence

TGCTGTAATGGACTTTCCCCGCGCCACAGTTCTATACCGAGAACGGTGGTGACTGAAATTGGGAGTGTCGTCATGAAGCGCATCGCAGTTGATCTGGCCA
AGTCCGTTTACCAAGTTGCCGAGAGTGTCCGTTCCGGCCTGGTGGTGCAGCGCAAGCGGCTGAACCGAGAGGCGTTCCGGCGATATATACAGGAGCAGAC
CGAGTCGGTCGAGTGGGTGATGGAAGCCTGTGGCACAGCGCACTATTGGGGGCGACTGGCGCAATCGCTCGGCCATCGGGTGAAGTTGCTGCATCCACGT
TACGTGCGGCCCTACCGCCGTCGCAACAAAACCGACCGCAATGACTGCGACGCCATGCTGGAAGCGGCACGCTGCACCGATATTCATCCCGTGCCGGTCA
AGAGCCACGGTCAGCAACAGCTTCAGCAATTGCACGGGCTACGTGAAACCTGGAAGAAGAGCCGCACCCAGCGAATCAATCTGCTGCGCGGCATGCTGCG
TGAAGCGGGTATCGAAGCGCCGGCTTCGACAGCCGACTTCATCCGGGCTGCCAGTGAGCCGGTTGATCTGCCTGAACTCGCGCCCCTGAGTTGTCTGCTG
CATATCGTTCTGGCCGAGATCAACCTGTATGAACAGTGCATGGCCGAATGCGAACAGCAGCTTCAGCGCTGGCATGCTGACGATGAAATAGTGCGCAAAC
TGGATGAGGTCAGTGGTATTGGTCTGTTGACCGCCAGTGCCCTGACCGCCGCTGTCGGTAAGCCCGAACGGTTCGCCAGTGGTCGCCAGCTCAGCGCTTG
GCTGGGCATGACGCCACGTGAGTTCAGCAGTGGCAATAGCCGCAAGCTCGGCCATATCAGCCGACAGGGCAATGTCTATGTGCGCACTTTGTTTATCCAT
GGATCCCGCGCGGCCTTGCTGGCGGCACAACGTTGCCAGGCTCGTACACCGGAAAAGCTGACCCAACTGCAGCGCTGGGCTGTGCAGACGGCAGCCCGTA
TCGGTCACAACAAGGCGGCGGTGGCGCTGGCCAACAAACTGGTGCGGATCTGCTGGGCGGTGTGGTGCCACGAGCGGCGGTTCAATGGCAATTGGCAGAG
CACAAAGCCCGCCTGACGGCGGGTGTAATCAGTAAGGCGTGGTGGTTTTCTTGTGGTTGTGGTGAGTAGCAGCACTGTCGAAACAGGCGAGTCCTGCAGC
GGAACAAGGCCGATAACAACGATGATCCCGGGGATCGATTGAACGCTTGGCCCCCGCTGCGCGAACTACAGAATGGCCAGGGCGGAAAGCCCAGAACAGG
CCGGATATACGAATGCAACCGCGCTGACGACAAGTGCAAAAGAAAAGCTTTGCCCGCTACTTGTGGGGAGAGTCCATATAT
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1044 bp347 aa731116+No
ORF function : Transposase
Chemistry : DEDD

ORF sequence :

MKRIAVDLAKSVYQVAESVRSGLVVQRKRLNREAFRRYIQEQTESVEWVMEACGTAHYWGRLAQSLGHRVKLLHPRYVRPYRRRNKTDRNDCDAMLEAAR
CTDIHPVPVKSHGQQQLQQLHGLRETWKKSRTQRINLLRGMLREAGIEAPASTADFIRAASEPVDLPELAPLSCLLHIVLAEINLYEQCMAECEQQLQRW
HADDEIVRKLDEVSGIGLLTASALTAAVGKPERFASGRQLSAWLGMTPREFSSGNSRKLGHISRQGNVYVRTLFIHGSRAALLAAQRCQARTPEKLTQLQ
RWAVQTAARIGHNKAAVALANKLVRICWAVWCHERRFNGNWQSTKPA

 

Blast result :
Comments
ISPa53 is 86% aa similar to ISKpn4.
The IR of this IS (8-ATGGACTTTCCCC-20 and 1365-GGGGAGAGTCCAT-1377)are not at its termini.
Like most IS1111 family elements, the first nt of the sequence shown (T) does match the 4th nt to the right of IRr (same base).
ISPa53 is embedded within and the L' motif of the attC recombination site of the aacA3 gene cassette, itself a part of the In996 class 1 integron, thereby preveting this gene cassette IntI-mediated excision.
References
1] Jové T. (2014) Direct submission to ISfinder