ISPa54

  • Family IS5
  • Group IS5
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Pseudomonas aeruginosa
Pseudomonas aeruginosa
DNA section
IS Length : 1159 bp

Ends


IR Length : 14/19

IRL : GGAAGGTCTGAAGAACTCGACCCAACTGGGCGACAATAGCGCACCACAAC
IRR : GAAGGTCTGATCAAAGCGCTCTGATGCTTGCATTTCAGCATCAAAGCACC

Insertion site


Left flankDirect repeatRight flankDR Length
CCGTGCACGACCTAACTGCGCGTAG5

DNA sequence

GGAAGGTCTGAAGAACTCGACCCAACTGGGCGACAATAGCGCACCACAACGAGGTTGACGTTCGATGCAGCTGACGTTCGGTGATGCCGAGGGCCTGGGC
AAGCGCAAGCGGACCCGCAAGGAGATCTTCCTGGCGGAGATGGAGCAGGTGGTGCCGTGGTCGGCGCTGCTGAAGCTGATCGAGCCGCACTATCCGAAGA
TGGGTCGTCCCGGCCGCCAGCCCTATCCGATCGCGACGATGCTGCGCATCCACTTCCTGCAGCAGTGGTACGCGCTCAGTGACCCGGCCATGGAAGAGGC
GCTGTACGACACGGCGGTGATGCGCCGCTTCGCCCGCCTCAGCGGGCTGGACAACATTCCGGACGAGACCACGATCCTCAACTTCCGCCGGCTGCTGGAG
ACGCATGATCTGGCGCCGCAGCTCCTGGAGCGCGTGAACGCGCACCTGGCGCGCAAGGGCCAGAGCTTGAAGGCCGGCACGATCGTGGACGCCACGATCA
TCGCGGCGCCGAGTTCGACCAAGAACAAGGACGGCGAGCGCGACCCGGAGATGCACCAGACGAAGAAGGGCAATCAGTGGCACTTCGGGATGAAGGCACA
CATTGGCGTGGACGATGAATCGGGCCTGGTGCATCACGTGGAATGCACGGCGGCGAACGTCAATGACGTGACGCAGGTGCACAAGCTGCTGCACGGCAAG
GAAGACATGATCTGCGGCGACAGCGGCTACACCGGTGCGCACAATCGCGAGGAACTGCAGGGCGTTGACGCCGCGTTCTGGATCGCGGAGAAGCCGTCGA
AGCTGCGCGCGATGAAGAACAAGCGCGAGCGCAAGTACGCCGAACGCTGGGAGCACTTCAAGGCCAGTCTAAGGGCAAAGGTTGAGCACCCGTTCCGAGT
GGTGAAGCGGCAGTTCGGCTACACCAAGGTGCGCTATCGCGGGCTGGCGAAGAACGCGGCACAGATGTGCACGCTGTTCGCGCTGTCGAACCTGTGGATG
GCGCGGCGACGTCTGTTGCTGCCGACGGGGTAACTCCGTCCGCTGGACGGGGAAACCCGTCGAAAACCGCCCGAAAAGGCGGAAAAATCGGTCAAATCGA
GGTCTGGCCGGTGCTTTGATGCTGAAATGCAAGCATCAGAGCGCTTTGATCAGACCTTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
969 bp322 aa651033+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MQLTFGDAEGLGKRKRTRKEIFLAEMEQVVPWSALLKLIEPHYPKMGRPGRQPYPIATMLRIHFLQQWYALSDPAMEEALYDTAVMRRFARLSGLDNIPD
ETTILNFRRLLETHDLAPQLLERVNAHLARKGQSLKAGTIVDATIIAAPSSTKNKDGERDPEMHQTKKGNQWHFGMKAHIGVDDESGLVHHVECTAANVN
DVTQVHKLLHGKEDMICGDSGYTGAHNREELQGVDAAFWIAEKPSKLRAMKNKRERKYAERWEHFKASLRAKVEHPFRVVKRQFGYTKVRYRGLAKNAAQ
MCTLFALSNLWMARRRLLLPTG

 

Blast result :
Comments
ISPa54 is 77% aa similar to ISXo1.
References
1] Chen L. (2014) Direct submission to ISfinder