ISHbo5

  • Family IS200/IS605
  • Group IS605
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP001690 ND Halogeometricum borinquense
Halogeometricum borinquense DSM11551
DNA section
IS Length : 2038 bp

Ends


Left end : ACGGGGCGAAAGCCTCGCCCTTCAGGGCGTTACCAGAACGCTAAGCGTTCTGGTTGCCCGCCAGACGTAGTCTGACGACGGGGATGAAGCCGACCAATAG II struct. : No
Right end : TCCCAAAGAAGTGCGCACAAACCCGCAAGTTGCCTCCGTGGGTCGGTAGCCGAACCCCCAACGGAGGAATCCTCGCGCTTTAGCGCGGGGAGGATGTCAA II struct. : No

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
CGGCAACCGCGTAAATACAACCGCAGAT

DNA sequence

ACGGGGCGAAAGCCTCGCCCTTCAGGGCGTTACCAGAACGCTAAGCGTTCTGGTTGCCCGCCAGACGTAGTCTGACGACGGGGATGAAGCCGACCAATAG
TATTCAACCGCCGCCGATGGCATAGACGGGGTTCAAACGCAGTCTTCAAGCCGTCCGACCGTGATAGTATGCATAGATGGTGAAGAGTACCCGTCACGCG
AAATACGAACTCTACTACCACATAGTGTTCGTGCCGAAATCTGGCGGAATCGAAGATTCCGCTGACCTCGCGGAACAGGGTTCCGCTCAGTATCGGCGTT
CGCACCTGACGGGGAAGACGAAGGAACGTCTCGAAACCATCTTCGCGGAAATCTGTGAGGACAAGGGCCTCGAACTGGCCGAGTCCGAGGTCATGCCCGA
CCACGTACACCTGTTCATTGGGAGTCCACCCAAGAACGCCCCGTCACTCATCGTCAACTGGGTCAAGGGCATCTCCGCCCGCAAGTACAACCAGCGGTAC
GATGACCGCGTGAAGTGGACTCGTTCGTACTACGTCGGGACGGCGGGGAGCGCCTCGAAGGGCGCTGTCGAACAGTACATCGCTGAACAGGAGGGTGGCG
ACGAATGAAGCGCGTCAACACCTTCGAGGTCGTGCCACAGACCGAGAACGACAAAGAGTGCCTTCTACGGCTACTCGACGCCTCCGCCTCGCTGTGGAAC
GAACTGACCTACGAACGTCGTCAGAACTACTTCGGTAACGGCGACGTGTGGGACACCTCCGAGTACCGTGGACAGTACAACGGTGTCGTTGGAAGCGCGA
CCGTTCAACAGGTCACGCGCAAGAACAGCGAAGCGTGGCGGTCGTTCTTCGCCCTCAAAGAGAAAGGCGAGTACGCCAACCCACCGTCGTACTGGGGCAA
CGAGGAGGACGGGCGCGAACTCCGCACCTACATTCGGTGCAACCAGTACACGATTGAGTGGGGGAAGCGTAGCCGTCTCGAAATCCCTGTTGGGCAAGAA
CTGAAAGACGAATACGGACTCGGCTACCACGAACGACTCCGCCTCGAAGTCCGAGGCAACCCGAAGTGGGACGGCAAACAGGGTCGTCTGGAACTTGAGT
ACGACGAAATGAGCGACACGTTCAGGGCTTTCCAACCAGTCACCGTCCCTGATTCTCGACTGGATTCACGGAAAATCGAAGATTTTCCTGAAGTCGAAAA
CGCTTCGCGTTTTCGGAATTCACCACTGGCTTCGGAAGAAGCCGCCCTCGACGTTGGCGCGAACAATCTCGTCGCCTGTTCCACGACCACTGGGAACCTG
TACCTCTACGACGGTCGGGAGTTGTTCGGACGGTTCCGCGAGACGACAGACGAAATCGCCCGCCTACAGTCGAAATTGCCCGAGAGACGCAGTCTCTCGG
AATCACGGAAGACTTCGTCTTCCGGACGACTCCGCGAAGGACGCTACTCCTCGAAACGGATTCGACGGCTGTACCGACAGCGGACGAAGCGCCGTGACCA
CGCACAGAACGCGCTGGTGCGCGACCTCGTTGAACGGCTGTACGACGAGGGAGTGGCGACGGTGTACGTGGGCGATTTGACCGACGTGCTGGAAACGCAC
TGGTCGGTCAGGGTGAACGAGAAGACGCACAACTTCTGGGCGTTCAAGAAGTTCATCCACCGTCTCGCGTGCGTCTGTGAGGAATACGGTATCAGCCTCG
AAGCCGAGTCGGAAGCGTGGACGAGTCAGACGTGTCCCGAGTGTGGCGACCACGAGGAGACGGTCCGCCACGGAGATACGCTGACGTGTTCATGCGGATT
CGAGGGACACGCCGACCTCACGGCGTCAGAGACGTTCCTTCGAGAAAACAGCGATACGGAAGTCAGGCCGATGGCACGGCCCGTGCGATTCGAGTGGGAC
GACCACGACTGGTCGGGGAAACCACACCCTCACGAAAGTCCCAAAGAAGTGCGCACAAACCCGCAAGTTGCCTCCGTGGGTCGGTAGCCGAACCCCCAAC
GGAGGAATCCTCGCGCTTTAGCGCGGGGAGGATGTCAA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
432 bp143 aa177608+No
ORF function : Transposase
Chemistry : Y1

ORF sequence :

MVKSTRHAKYELYYHIVFVPKSGGIEDSADLAEQGSAQYRRSHLTGKTKERLETIFAEICEDKGLELAESEVMPDHVHLFIGSPPKNAPSLIVNWVKGIS
ARKYNQRYDDRVKWTRSYYVGTAGSASKGAVEQYIAEQEGGDE

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1383 bp460 aa6051987+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MKRVNTFEVVPQTENDKECLLRLLDASASLWNELTYERRQNYFGNGDVWDTSEYRGQYNGVVGSATVQQVTRKNSEAWRSFFALKEKGEYANPPSYWGNE
EDGRELRTYIRCNQYTIEWGKRSRLEIPVGQELKDEYGLGYHERLRLEVRGNPKWDGKQGRLELEYDEMSDTFRAFQPVTVPDSRLDSRKIEDFPEVENA
SRFRNSPLASEEAALDVGANNLVACSTTTGNLYLYDGRELFGRFRETTDEIARLQSKLPERRSLSESRKTSSSGRLREGRYSSKRIRRLYRQRTKRRDHA
QNALVRDLVERLYDEGVATVYVGDLTDVLETHWSVRVNEKTHNFWAFKKFIHRLACVCEEYGISLEAESEAWTSQTCPECGDHEETVRHGDTLTCSCGFE
GHADLTASETFLRENSDTEVRPMARPVRFEWDDHDWSGKPHPHESPKEVRTNPQVASVGR

 

Blast result :
Comments
ISHbo5 is 86% aa (ORFA : the transposase) and 90% aa (TnpB) similar to ISHhu1.
References
1] Pfeiffer F. (2013) Direct submission.
2] Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H., Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K., Mikhailova,N., Anderson,I., Brettin,T., Detter,J.C., Han,C., Larimer,F., Land,M., Hauser,L., Markowitz,V., Cheng,J.-F., Hugenholtz,P., Woyke,T., Wu,D., Tindal,B., Klenk,H.-P. and Eisen,J.A. (2009) Direct submission GenBank.