ISLho2

  • Family IS5
  • Group IS5
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Lactobacillus hokkaidonensis
Lactobacillus hokkaidonensis LOOC260
DNA section
IS Length : 1557 bp

Ends


IR Length : 13/14

IRL : GTGGATGGTATTTAATTTAAAATATTAATAAGTATGGGCATTAAGACCGA
IRR : GTGGATGGTATCTTAGGCCACTAAATTTGATAGCCGATTAATCATTTTGT

Insertion site


Left flankDirect repeatRight flankDR Length
TTTATTAATTTAATTATTAAACAAAT6
TAATTCGAAGTAGCGTACTTTTGCCAC7
TTACCTTTCGTAAATATGCTTGATAA6
CAATTGTATATAATTAGTATGTAAAC6
ACTTGATCTTTAGTTAAATAATCTTT6
CGGAAAATCATAATTAGAACACCAAT6

DNA sequence

GTGGATGGTATTTAATTTAAAATATTAATAAGTATGGGCATTAAGACCGATATATTGTAAAATAAATGTATACATATTCCTGAATAAGCAAGAATTTTCG
TGCATTTATAAATACTATCGGAGGTGTCACCTATGGTTTACCGTAAAAAGACAGTACAATTATCAATTAATTCTTTTGAAACTGCTTTAGGATGTCCGCT
GAGTGCAGATAATGAATGGGTTCAATTAGCTAATCAATTACCTTGGAGTGAATGGGACGAAGTATACCAATTGGCTTTTCCGTCCAATTTGGGTCGTGCT
GGTAAACCATTTAGACAATTATATGGAGCCCAACTAATCAAGCAACGAACAGGCCTTTCCGATCGTGAAGTAGTTGATGCTATTCGGGATACTCCAGCTT
ATCAATATTTTCTCGGCTTTTCAGAGTACCAACCAGTTCGACCTTTCGATCATGTAACACTTGTATACTTTCGTAAACGGATTGCTCCAATTTCAGACCA
GATTCTTAATATCATGGCAAAATACACAGGAAAACTACTCAATGAAGCATTGCCAGATAAAAGAGTGGTAATCACTGATGCTACGGCTTTTCCAGTTAAT
GTTGCGTATCCGCAGGATACACATCTGCTTAATGGAACACGGCTCAAGTTAGAGGCAGATATCAAACTAATGTCTAATCAGTTGAAGTTAGCTCCGCCAC
GCACGCGTAAGCGTGAAGCTAAAAAACAATGGGTTGCTTTTTCTCGCCATCCACATCGTTGGGGAAAACAGACTCATAAGCAAATTAAAGCCCAGCTTCA
ATATATTCGACGCGATTTACGTTTCGTTGATGAACTACTCGCGCAAGGAGGCCAGTTAAGTGAACGCCGTTTGAAAGTTTTGAGCACAGTACGTAAAGTC
TATGAACAGCAGGATTATATGTACCGTAATCATACGCATCATGTTAGTGACCGTATTGTAAGCCTGACTCAGCCTGAAATTAGGCCGATTGTACGAGGGA
AAGCTAAACAACCAGTAGAATTTGGACCTAAGGTTGATCTATCAATTACAGATGGTGTTGTTAACATTGAACGATTCTCATTTGATTCCTTCAATGAAAG
TACTGATTTCGCTTCAACCATAGATCACTATAAGGATGTTCATGGAGTCTATCCTGATGAGGTCTTAGCAGATACACTTTATCGAACACGAGCCAACATT
AAGTTGTGCAAAGACTTAGGAATTAAATTAAGTGGTCCTAAGCTTGGCCGAAGGCCTAAACACGTAGATCCAGCTAAACGTCGTGAAGAACAAGATGCAG
AAAATCGGCGTGGTGAAATAGAGCGCGAGTTCTCACTGATTAAGAGCAAACTTGGGCTAGGTTTAGTGACCGCCAAAACTGCAGAAACAATTGCCGTAAC
AGTTGACACTGGAGTTGTATTGGCCAATCTTAAACGTGTATTGAGCTTTTTTTGTGTACCAATTTCTATATTCGTCGAAATGGATGGTGTAAAGCTTCAA
ATAGATTACAAAATGATTAATCGGCTATCAAATTTAGTGGCCTAAGATACCATCCAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1413 bp470 aa1331545+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MVYRKKTVQLSINSFETALGCPLSADNEWVQLANQLPWSEWDEVYQLAFPSNLGRAGKPFRQLYGAQLIKQRTGLSDREVVDAIRDTPAYQYFLGFSEYQ
PVRPFDHVTLVYFRKRIAPISDQILNIMAKYTGKLLNEALPDKRVVITDATAFPVNVAYPQDTHLLNGTRLKLEADIKLMSNQLKLAPPRTRKREAKKQW
VAFSRHPHRWGKQTHKQIKAQLQYIRRDLRFVDELLAQGGQLSERRLKVLSTVRKVYEQQDYMYRNHTHHVSDRIVSLTQPEIRPIVRGKAKQPVEFGPK
VDLSITDGVVNIERFSFDSFNESTDFASTIDHYKDVHGVYPDEVLADTLYRTRANIKLCKDLGIKLSGPKLGRRPKHVDPAKRREEQDAENRRGEIEREF
SLIKSKLGLGLVTAKTAETIAVTVDTGVVLANLKRVLSFFCVPISIFVEMDGVKLQIDYKMINRLSNLVA

 

Blast result :
Comments
ISLho2 is 75% aa similar to ISLrh2.
6 copies were found in the chromosome of Lactobacillus hokkaidonensis LOOC260.
References
1] Tanizawa Y, Tohono M, Kaminuma E, Nakamura Y, Arita M (2014) Genome sequencing and comparative genomics of psychrotrophic Lactobacillus hokkaidonensis LOOC260T (on preparation)