ISPko2

  • Family IS256
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Paracoccus kondratievae
Paracoccus kondratievae NCIBM 13773 plasmid pKON1
DNA section
IS Length : 1396 bp

Ends


IR Length : 29/37

IRL : GGTCGTGTCTCGGAACTGGTGGAAATTGGCTGGCGGCGTAATCTCCGGGT
IRR : GGTCGTGTCGCGAAGGCTGTGGAAATTCCCTGGCGGCTTGCTCCGGGCAT

Insertion site


Left flankDirect repeatRight flankDR Length
GTTCTGGTATGCGCCTTTTCAATCTACG8

DNA sequence

GGTCGTGTCTCGGAACTGGTGGAAATTGGCTGGCGGCGTAATCTCCGGGTGAACTCACACCCACCCAACCGGCGGCGGCAACCGCCAGGGAGATCACGCC
ATGAAGCAGAATACCGACACCCCGTCCTTTTCGCTACTGTCCGACGTAGGCGGATATGATCCAATCGAAGACCGCCTGCGGGCGAATGTGCGCGCGACGA
TCGAGGCTTTGTTCGAGGAAGAACTGGCCGAGTTTCTCGGCCGCCTGCGCTACGGCCGCGGCGACGACAAGGCCAAGAAGGGCTACCGCCACGGGCATCG
AGACCGACAACTGACCGGCACATTCGGCACCGAGACGGTGCGGGTGCCGCGCGCCCGGATCGAGGGCGAGGCGGGCAAAGTCACCGAATGGCGCTCGCAG
GCATTGCCGCGCTACCAGCGTCTAACGAAAAAGGCCGAAGCCCTGATCGCGGCGGTCTACCTGGCCGGGACGAATACGCGTCGGGTCAAGCGGGCGCTGT
TTGGTCTGTTCGAGGGGGCAGTGAGCAAGGACGTGGTCAGCCGGGCCTGGCGCAAGGTGAAGGTGGATTGGGACGCCTGGTCGATGCGTGACCTGGCCGA
GGAGGACATCGTCCGGCTCATTCTCGATGGCACCGTCATCAAGACCCGGCTGGACCGCAAGGCCACCAATATCTCGGTCCTAGCCGCGATCGGCGTCCGT
CGCGACGGGCAGAAGGTGCTGATCTCGATCAGGAATATGGGCGGCGAAAGCACAGCTGCCTGGTGTCAGTTCCTCACCGATCTGGATGCACGGGGCCTGA
AACGACCGGAGTTCGTGATCGTCGACGGTGCGCCCGGCTTGGAAGCCGCGCTCGTGGCGCTCTGGGGCGAGGAGCTGCCCATTCAACGCTGCACCGTTCA
CAAGCACCGAAACCTGCTCGGCCACGCGCCCAAGCGCTTGCATGACGAACTGAGCGAGGATTACCGCGACATGATCTACGCCGATACCGCCGCCGAGATC
GAGAAGCGCCGCAAGGCCTTCCTCCGCAAGTGGAAGCTCAAGTGCCGGGCGGTGGCCGATAGCCTTGATGAAGCAGGCGACCGGCTCTTCAGCTTCACCC
GCCTTGATCCCTCGCAATGGAAATCCGCACGGACCACCAATGCCATCGAGCGCCTGAACGAGGAGTTCCGCCGCCGCATCAAGACCCAGACCGTGCTGCC
CTGCGCCGAAACCGTGCCGATGCTGCTCTGGGCGCTCTTGGCGTCAGGGCAGATCCAGATGCGGAAGGTCGACGGCTGGGAGACCCTGTCTCACCCTCTC
GTGCCGATGTCCCTTGACCTCGCGGCCTAACCCGCGCCAACTTCACATGCCCGGAGCAAGCCGCCAGGGAATTTCCACAGCCTTCGCGACACGACC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1230 bp409 aa1011330+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKQNTDTPSFSLLSDVGGYDPIEDRLRANVRATIEALFEEELAEFLGRLRYGRGDDKAKKGYRHGHRDRQLTGTFGTETVRVPRARIEGEAGKVTEWRSQ
ALPRYQRLTKKAEALIAAVYLAGTNTRRVKRALFGLFEGAVSKDVVSRAWRKVKVDWDAWSMRDLAEEDIVRLILDGTVIKTRLDRKATNISVLAAIGVR
RDGQKVLISIRNMGGESTAAWCQFLTDLDARGLKRPEFVIVDGAPGLEAALVALWGEELPIQRCTVHKHRNLLGHAPKRLHDELSEDYRDMIYADTAAEI
EKRRKAFLRKWKLKCRAVADSLDEAGDRLFSFTRLDPSQWKSARTTNAIERLNEEFRRRIKTQTVLPCAETVPMLLWALLASGQIQMRKVDGWETLSHPL
VPMSLDLAA

 

Blast result :
Comments
ISPko2 is 92% aa similar to ISPaes3.
ISPko2 was identified by in silico nucleotide sequence analysis of Paracoccus kondratievae plasmid pKON1 (95 kb). This IS is present in 1 copy in the pKON1 genome.
References
1] Czarnecki J. (2015) Direct submission